KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03217Help
Entry
BMULJ_03217       CDS       T00740                                 

Gene name
gutB
Definition
(GenBank) L-iditol 2-dehydrogenase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc Methyltransf_25 Methyltransf_12 TrkA_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: BAG45091
UniProt: A0A0H3KIR6
LinkDB All DBs
Position
2:complement(19946..21067)
Genome map
AA seq 373 aa AA seqDB search
MRALQWHGPRDVRLVDIDTPRVGPGEVRIAVAYCGICGSDLHEYADGPHAIPVDAPHPLS
GRTAPLTLGHEFCGTVVEVGAGVTTLRAGDRVAVEPEYRCQRCAYCRAGSYNLCVSMGFA
GLMGDGGMADFAVVPAYMLHRLPEGVTLEQAAVLEPAAVALHALRRGELRLGNTCAVFGL
GPIGLLLIMLAKLQGATTIVAVDVSPQRLAAAKRFGATRAFDARSLDAAALRDAIRAETG
GLGVDVAFEAAGLPATFEAAMHALRKGGRVVMVGLMPHAGFDAFRAVNDELTFTASVGYR
HAYDDLLRIVASGVLDPASIVTRTVALEHAIADGFDALLADRTQIKVLVSPALGASRRTY
ASGSIEHEPSADV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcacttcaatggcatggcccgcgcgacgtccgtctcgtcgacatcgacacgccg
cgcgtcgggccgggcgaggtacgcatcgccgtcgcgtattgcggcatctgcggcagcgat
ctgcacgaatacgcggacggcccgcacgcgattccggtcgacgcaccgcatccgctgtcc
gggcgcaccgcaccgctgacgctcggtcacgagttctgcggcaccgtcgtcgaagtcggc
gcgggcgtgacgacgttgcgcgccggcgaccgtgtcgcggtcgagcccgagtatcgctgc
cagcgctgcgcgtactgccgggccggctcgtacaacctctgcgtatcgatgggctttgcc
gggctcatgggcgacggcggaatggccgacttcgcggtcgtgccggcctatatgctgcat
cgcctgcccgagggcgtcacgctcgaacaggcggcagtgctcgagcccgccgccgtcgcg
ctgcatgcactgcggcgcggcgagctgcggctcggcaatacctgcgcggtgttcggcctc
ggaccgatcggactgctgctgatcatgctcgcgaagctgcaaggggcgaccacgatcgtc
gccgtcgacgtgtcgccgcagcgcctcgcggccgcgaagcgcttcggcgcgacgcgcgcg
ttcgacgcccgctcgctcgatgcggccgcgctgcgcgacgcgattcgcgcggaaaccggc
ggcctcggcgtcgacgtcgcgttcgaggcggccgggctgcccgcgacgttcgaagccgcg
atgcacgccttgcgcaaaggcggacgcgtcgtgatggtcggcctgatgccgcacgcgggc
ttcgatgcgtttcgcgccgtcaacgacgagctgaccttcacggcgagcgtcggctaccgg
cacgcgtacgacgatctgctgcgcatcgtcgcgtccggcgtactcgatccggcgtcgatc
gtcacgcgcaccgtcgcgcttgagcacgcgatcgccgacggcttcgacgcgctgctcgcc
gaccgcacgcagatcaaggttctcgtttcaccggcgctcggcgcgagccgccgcacctat
gcctcggggagcatcgaacatgagccaagcgcagacgtttga

DBGET integrated database retrieval system