KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03218Help
Entry
BMULJ_03218       CDS       T00740                                 

Definition
(GenBank) permease of the major facilitator superfamily
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like LacY_symp Nuc_H_symport
Motif
Other DBs
NCBI-ProteinID: BAG45092
UniProt: A0A0H3KIL7
LinkDB All DBs
Position
2:complement(21069..22379)
Genome map
AA seq 436 aa AA seqDB search
MLFRSFPRPAWTYENRLLLILFMTFGFVFFDRLALSFLFPFMAAELHLTNAQLGMVSSAL
ALTWALSGAVTGAWSDARGTRKPLLIAAVLGFSVCSALSGFVGGFASLIAFRALMGIAEG
PVLPLSQSLMIESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVVIGIASAAGWREAFYVSC
IPGIAIAFCIWRWVRETPPGGAIDARADACSATKDTAKGATVSRWALLKARNVLLCVLIS
CFFLTWFVVVISFAPTFLVSSRHFSASDMGVVMTCLGAAWVFWGFAVPAISDRIGRKPTM
IVFALIAALCPLAMIHIASLWALCALVFATYTGLGCFTLFMATIPAETVPPGAVASALGL
IMGAGELIGGFVAPTVAGFAADRFGLSFAMEMSAAGALVAGLLSIGLVETAPAVLRRRAL
ASAAARRFDTQNLGGR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgctattccgatcttttcctcgaccggcgtggacgtacgagaacaggttgctgctgatc
ctgttcatgacgttcggcttcgtcttcttcgaccgcctcgcgctgtcgttcctgtttccg
ttcatggcggccgaactgcatttgaccaatgcgcagctcggcatggtgtcgtccgcgctt
gcgctcacgtgggcgctgtccggcgccgtgacgggcgcgtggtccgacgcgcgcggcaca
cgcaagccgctgttgatcgcggccgtgctcggcttctccgtgtgctccgcgctgtcgggc
ttcgtcggcggcttcgcgagcctgatcgcattccgcgcgctgatgggcatcgccgaaggg
cccgtcctgccgctgtcgcagtcgctgatgatcgagagttcgacgccgagccgtcgcggg
ctgaacatgggcctgctgcaagggtccgccgcgggcctgctcggcgcgatgatcggcccg
ccggtcgtgatcggcatcgcctccgcggccggctggcgcgaagcgttctacgtgtcgtgc
attcccggcatcgcgatcgcgttctgcatctggcgctgggtgcgcgagacaccgccgggc
ggcgcgatcgacgcgcgcgcagatgcgtgcagcgcaacgaaggacacggcgaagggcgcg
acggtcagccgctgggcgctgctgaaggcgcgcaacgtcctgctgtgcgtgctgatcagc
tgctttttcctcacgtggttcgtcgtcgtgatctcgttcgcaccgacattcctcgtgagc
agccgtcatttttccgcatccgacatgggcgtcgtgatgacatgcctcggtgccgcctgg
gtgttctggggcttcgcggtgcccgcgatctcggaccgcatcggccgcaagccgacgatg
atcgtgttcgcgctgatcgccgcactgtgcccgctcgcgatgatccatatcgcgtcgctc
tgggcgctctgcgcgctcgtattcgcgacctatacgggcctcggttgcttcacgctgttc
atggcgacgattccggccgagacggtgccgcccggcgcggtcgccagtgcgctgggcctg
atcatgggcgcgggcgaattgatcggcggtttcgtcgcgcccaccgtcgcgggcttcgcc
gcggaccgcttcgggctgtcgttcgcgatggagatgtcggccgcaggcgcactcgtcgcc
ggcctgctgtcgatcggcctcgtcgaaactgcgcccgcggtattgcgcaggcgcgcgctc
gcgagcgccgccgcgcgccgtttcgatacgcaaaacctcggaggacgctga

DBGET integrated database retrieval system