KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03219Help
Entry
BMULJ_03219       CDS       T00740                                 

Definition
(GenBank) 2,4'-dihydroxyacetophenone dioxygenase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: BAG45093
UniProt: A0A0H3KND4
LinkDB All DBs
Position
2:complement(22398..22931)
Genome map
AA seq 177 aa AA seqDB search
MVDKAVAEFWQNIAPIANPFKPDALPEAYIPNAASDDERYYVPFTETVSSRPLWISPTQN
KWCDILMAKQAGLVNRHYHPHEVFAYTISGKWGYLEHEWTATRGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDDEGNPDGYFDVHSYIAMCKAHYEKVGLGAHAVEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacaaagccgtagccgaattctggcaaaacatcgcgccgattgccaatccgttc
aagcccgatgcgctgcccgaggcgtacattccgaacgccgcgtcggacgacgaaagatat
tacgttccgttcaccgaaacggtttcatcgcggccgctgtggatatcgccgacgcagaac
aaatggtgcgacatcctgatggccaaacaggccgggctcgtgaatcgccactatcacccg
catgaagtgttcgcttacacgatctccgggaagtggggctacctcgagcacgagtggacg
gccacgcgcggcgacttcgtgtacgaaacgccgggcgaaggccatacgctcgtcgcgttc
gatcatccggagccgatgcgcgcgttcttcatcgtcaagggcccgctgatctggctcgac
gacgaaggcaatcccgacggctacttcgacgtgcattcgtacatcgcgatgtgcaaggcg
cattacgagaaggtcgggctcggcgcgcacgcggtcgagaagctgtttcgctga

DBGET integrated database retrieval system