KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_04014Help
Entry
BMULJ_04014       CDS       T00740                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_binding_3 HI0933_like Glutaredoxin K_oxygenase FAD_oxidored Thi4 DAO FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAG45873
UniProt: A0A0H3KUD6
LinkDB All DBs
Position
2:complement(895654..897252)
Genome map
AA seq 532 aa AA seqDB search
MLDANLKTQLKAYLEKITRPIELVASLDDSAKSQELRALLDEIASLTTRVTVIERRDDEA
RTPSFSIGEPGQPARIRFAGIPMGHEFTSLVLALLQTGGHPVKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQDEVEARQIMAVPTMFLNGES
FGQGRSSVKEILAKLDTGAGARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRAEALIPGDVHQ
IRLANGAVLKARTVVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKAVTLIEYGAQLRADEVLQRKLRSLPNVTVITEAQTTELTGDGSKL
NGLVYTDRRSGEVKRIELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDATPAVDTQPQADEAVAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagacccaactcaaagcgtacctcgaaaaaatcacgcgcccg
atcgaactcgtcgcatcgctcgacgacagcgcgaagtcgcaggaactgcgtgcgctgctc
gacgagattgcatcgctgacgacgcgcgtcaccgtgatcgaacgccgcgacgacgaggcg
cgcacgccgtcgttctcgatcggcgaaccgggccagcccgcgcggatccgcttcgcgggc
attccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccggtcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgacggcgactatgcg
ttcgagacgtacttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgtcacgtcgcgatcgacggcgcgctgttccag
gacgaagtcgaagcacgccagatcatggcggtgccgacgatgttcctgaacggcgaatcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgatacgggcgccggc
gcacgcgcggcgaagtcgctcgagaacaagccggtgttcgacacgctgatcgtcggcggc
ggcccggccggtgcggcggccgcgatctactcggcgcgcaagggcatcgcgaccggcgtg
gtcgccgaacgtttcggcggccaggtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaaggaccgaagttcgcgactgcgctcgaacaacacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgccgaagcgctgattcccggcgacgtgcatcag
atccgcctcgcgaacggcgccgtgctgaaggccaggacggtcgtgctcgcgacgggcgcg
cgctggcgcgagatcaacgtgcccggcgaacgcgaataccgcaaccgcggcgtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtcgtcggcggcggc
aactcgggcgtcgaggccgcgatcgatctcgcgggcatcgtgaaggcagtcacgctgatc
gaatacggcgcgcagctgcgcgcggacgaagtgctgcaacgcaagctgcgcagcctgccg
aacgtgaccgtcatcaccgaagcgcagacgaccgagctgaccggcgacggcagcaagctg
aacgggctcgtgtatacggaccgtcgctcgggcgaggtgaagcggatcgaactcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacacggaatggctgaagggcacggtcgagctg
tcgaagcacggcgagatcgtcgtcgatgcacgcggcgcgacgtcggtgcccggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgattgcggtcggcgaaggc
gccaaggcgtcgctcggtgcattcgatcatctgatccgccaggacgcgacgccggctgtc
gacacgcaaccgcaagccgacgaagcggtcgccgcctga

DBGET integrated database retrieval system