KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_04373Help
Entry
BMULJ_04373       CDS       T00740                                 

Gene name
gutB
Definition
(GenBank) L-iditol 2-dehydrogenase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C DAO UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: BAG46228
UniProt: A0A0H3KV46
LinkDB All DBs
Position
2:1333910..1334971
Genome map
AA seq 353 aa AA seqDB search
MKAAVWRGRRDIRVEEVPVPERPPAGWVKIRVHWCGICGSDLHEYVAGPVFIPVDAPHPL
TGLKGQCILGHEFSGEIAELGDGVTGFAIGDRVTADACQHCGTCWYCTHGLYNICENLAF
TGLMNNGAFAEYVNVPAELLYRLPDGFPTEAGALIEPLAVGLHAVKKAGSIVGQTVVVVG
AGTIGLCTIMCAKAAGAGRVIALEMSDARKAKALEVGASVVIDPKTSDAIAEVKALTGGY
GADVSFECIGHTTTAKLAIDVIRKAGKSVMVGIFEEPAPFNFFDIVSTEKEVIGSLAYNG
EFADVIRFIADGRIDVQPLITGRIALGDIVARGFEELVHHKDRNVKIIVQPAT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtgtggcgcggccgccgcgacatccgcgtcgaagaggttcccgtaccg
gagcggccgccggccggctgggtgaagatccgcgtgcactggtgcggcatctgcggctcg
gacctgcacgaatacgtcgccggccccgtattcattccggtcgacgcgccgcatccgctg
acgggcctgaaaggccagtgcatcctcggtcacgagttcagcggcgagatcgccgagctc
ggcgacggcgtgacgggcttcgcgatcggcgaccgcgtgacggccgacgcctgccagcat
tgcggtacctgctggtactgcacgcacgggctctacaacatctgcgaaaacctcgcgttc
accggcttgatgaacaacggcgcgttcgcggagtacgtcaacgtgccggccgaactgctg
taccggctgcccgacggcttcccgaccgaagccggcgcgctgatcgagccgctcgcggtc
gggctgcacgcggtgaagaaggccggcagcatcgtcgggcagaccgtcgtcgtggtcggc
gcgggcacgatcgggctgtgcacgatcatgtgcgcgaaggccgccggcgcgggccgcgtg
atcgcgctcgagatgtccgacgcgcgcaaggcgaaggcgctcgaagtcggcgcgagcgtc
gtcatcgatccgaagacgtcggacgcgatcgccgaggtgaaggcgctgacgggcgggtac
ggcgccgacgtgtcgttcgaatgcatcggccacacgacgacggcgaagctcgcgatcgac
gtgatccgcaaggccggcaagtcggtgatggtcgggatcttcgaagagccggcgccgttc
aacttcttcgacatcgtgtcgaccgagaaggaagtgatcggctcgctggcgtacaacggc
gagttcgcggacgtgatccgcttcatcgcggacggccggatcgacgtgcagccgctgatc
accggccgcatcgcgctcggcgacatcgtcgcgcgcggcttcgaggagctcgtccatcac
aaggaccgcaacgtgaagatcatcgtgcagccggcgacctag

DBGET integrated database retrieval system