KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_04547Help
Entry
BMULJ_04547       CDS       T00740                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: BAG46398
UniProt: A0A0H3KMV3
LinkDB All DBs
Position
2:complement(1545517..1546212)
Genome map
AA seq 231 aa AA seqDB search
MTLDHPVFTRWPARHPDRLQLFSLPTPNGVKVGIMLEETGLAYEAHRIDILANAHHDPAF
VALNPNGKIPAIYDPNGPGGRPLALFESGAILVYLADKTGQFLSADPHVRYETLQWLMWQ
MGGVGPMFGQVGFFNRFAGKAYEDKRPLNRYVAESARLLGVLDERLAGRDWVMGADYSIA
DMSLLGWVRNLIGFYEARELVDFDRFVHVNAWLERGLARPAVQRGLQVAAS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtgacactcgatcatcccgttttcacgcgctggccggcgcgccatcccgatcggctccag
ctcttttcgctgccgacgcccaacggcgtgaaggtgggcatcatgctggaagagacgggc
ctcgcgtacgaggcgcatcgcatcgatattctcgcgaacgcgcatcacgatccggccttc
gtcgcgctcaaccccaacggcaaaattccggcgatctacgatccgaacggaccgggcggc
cgaccgctcgcgctgttcgaatccggcgcgatcctggtctatctcgccgacaagaccggg
caattcctgtcggccgatccgcacgtgcgatacgagacgctgcagtggctgatgtggcag
atgggcggcgtcgggccgatgttcggtcaggtcggcttcttcaaccggttcgccggtaaa
gcgtatgaagacaagcgtccgttgaaccgctacgtcgcggagtccgcgcggctgctcggc
gtgctcgacgaacgtcttgcgggccgcgactgggtgatgggcgccgattacagcatcgcc
gacatgtcgttgctcggctgggtgcgcaatctgatcggcttttacgaagcgcgcgagctg
gtcgacttcgaccgctttgttcacgtgaacgcgtggctcgagcgcggtctcgcgcgcccg
gcggtgcagcgcgggctgcaggtggccgcgagctga

DBGET integrated database retrieval system