KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05162Help
Entry
BMULJ_05162       CDS       T00740                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAG47001
UniProt: A0A0H3KNX6
LinkDB All DBs
Position
2:2221472..2222761
Genome map
AA seq 429 aa AA seqDB search
MTVKNADLLARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRH
PKIVKAIAEQLELFTHTAYQIVPYASYVELAEKINERAPGDFPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVT
TADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIAD
EVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYA
GNPLAVASAHAVLEIIDEEKLCERATQLGDTLKAKLNALQAEVPQIADVRGPGAMIAVEF
MKPGTGEPDAEFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALAILEEV
LKETVGVPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagaatgccgacctgctggcccgcaagaacgccgcgaccccgcgcggcgtc
ggagtgatgtgcgacttctacgccgcccgcgccgagaacgcggagctgtgggacgtcgaa
ggccgccgtttcatcgatttcgccgcgggcatcgcggtgctgaacacgggccatcgtcat
ccgaagatcgtcaaggcgatcgcggagcagctggagctcttcacgcacaccgcctaccag
atcgtcccgtacgcgtcgtacgtcgagctggccgaaaagatcaacgaacgcgcgccgggc
gacttcccgaaaaagacggcgttcttcacgaccggtgccgaagccgtcgaaaacgcgatc
aagatcgcacgcgcggcaacgggccgtccgggcgtgatcgcgttctcgggcggcttccac
ggccgcacgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttc
ggtccgttcccgggcgacgtgttccacgcaccatacccgaacgccgtgcacggcgtgacg
accgccgactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgc
gtcgccgcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggcc
gagttcgtccgcgcgctgcgcaagatctgtaacgagcacggcatcctgctgatcgccgac
gaagtgcagacgggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgacgtg
ctggccgacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtc
gtcggccgtgcggacgtgatggacgcggccgccccgggcggcctcggcggcacgtacgcg
ggcaacccgctcgcggtcgcgtcggcgcacgcggtgctcgagatcatcgacgaagaaaag
ctgtgcgagcgcgcgacgcagctcggcgacacgctgaaggcgaagctgaacgcgctgcag
gccgaggtgccgcagatcgccgacgtgcgcggcccgggtgcgatgattgcggtcgagttc
atgaagccgggcaccggcgagccggacgccgaattcacgaagcgcgtgcaggcgcgtgcg
ctcgagcgcgggctgctgctgctcgtctgcggcgtgtactcgaacgtcgtgcgcttcctg
ttcccgctgacgatcccgcaagccgtgttcgacgaagcgctcgcgatcctcgaggaagtg
ctgaaggaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system