KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05998Help
Entry
BMULJ_05998       CDS       T00740                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00020  Citrate cycle (TCA cycle)
bmj00190  Oxidative phosphorylation
bmj00650  Butanoate metabolism
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
bmj01130  Biosynthesis of antibiotics
bmj01200  Carbon metabolism
Module
bmj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMULJ_05998 (sdhB)
   00650 Butanoate metabolism
    BMULJ_05998 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BMULJ_05998 (sdhB)
Enzymes [BR:bmj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BMULJ_05998 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BMULJ_05998 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-ProteinID: BAG47799
UniProt: A0A0H3KRT4
LinkDB All DBs
Position
3:complement(722579..723289)
Genome map
AA seq 236 aa AA seqDB search
MDDDTRILHIYRYDPDRDAAPYMQRYEITVQPDDRMLLDVLGRLKREDETLSYRRSCREG
ICGSDAMNINGSNGLACLTNMKTLPREITLRPLPGLPVVRDLIVDMTDFFNQYHSIKPYL
INDTPPPERERLQSPAERDQLDGLYECILCACCSTQCPTFWWNPDKFVGPAGLLQAYRFI
ADSRDLATGERLDNLEDPYRLFRCRTIMNCTSVCPKGLNPARAISNIRAMLVRRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgacacgcgcatcctccatatctatcgctacgaccccgatcgggacgcggcg
ccttacatgcagcgttacgagatcaccgtgcagcccgacgaccggatgctgctcgacgtg
ctcgggcgcctgaagcgcgaagacgagacgctctcgtatcgccgttcgtgccgcgaaggg
atctgcggctccgatgcgatgaacatcaacggctcgaacgggctcgcatgcctgaccaac
atgaagacgctgccgcgcgaaatcacgctgcgcccgctgccggggctgccggtcgtgcgc
gacctgatcgtcgacatgaccgattttttcaatcagtaccactcgatcaagccgtatctg
atcaacgacacgccgccgcccgagcgtgagcggctgcagtcgcctgccgagcgcgatcag
ctcgacgggctgtacgaatgcatcctctgcgcgtgctgctcgacgcagtgtccgacgttc
tggtggaatccggacaagttcgtcgggccggccgggttgctgcaggcctaccgcttcatt
gccgattcgcgtgatctcgcgaccggcgagcggctcgacaacctcgaggatccgtatcgg
ctgttccgctgccggacgatcatgaactgcacgagcgtgtgtccgaaggggctgaatccg
gcgcgcgcgatctcgaacattcgcgcgatgctggtgcggcgcgcggtgtag

DBGET integrated database retrieval system