KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_06006Help
Entry
BMULJ_06006       CDS       T00740                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00500  Starch and sucrose metabolism
bmj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMULJ_06006
Enzymes [BR:bmj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BMULJ_06006
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BMULJ_06006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: BAG47807
UniProt: A0A0H3KR08
LinkDB All DBs
Position
3:731947..735357
Genome map
AA seq 1136 aa AA seqDB search
MKREDSLDDVRRAQFASHPHAGSPRQRRVRRPAPALCADDPLWYKDAIIYQVHVKSFFDS
NNDGIGDFPGLIAKLDYIAELGVDAIWLLPFYPSPRRDDGYDISDYRDVHPDYGTLADVR
RFIREAHARGIRVITELVINHTSDQHPWFQRARRAKPGSMYRNYYVWSDTDTKYAGTRII
FLDTETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVLQVMRFWLDLGIDGLRLDA
VPYLVEREGTNNENLPETHAILKRIRATIDAEYPNRMLLAEANQWPEDVQEYFGNEDECH
MAFHFPLMPRIYMSIASEDRFPIIDIMRQTPALAPSNQWAVFLRNHDELTLEMVTDSERD
LLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDEIGMGDN
IHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMGSLYGYDAINVEAQTRDPHSLLN
WTRRILATRRATQVFGRGSIRFLRPENRKVLAYLRELEGHDPVLCVANLSRASQAVELDL
SEFAGRVPIEMTSDSPFPPVGQLPYLLTFPPYGFLWFVLSAHGREPAWRQPHAEPLPEYV
TLVMRRGDTRPDVAQLHTLAHDALASWLTRRRWFASKDRTIADARLNVVTPIPGESFQYA
EACVTVRGDSHAERYVVPLAVAWGGETSGPLFAQLALARVRRGHTVGYLTDAFALPAFAH
GMLRKLRAGATVPTSDGGHLAFLPEAALASLDPGDEAEVRWLAAEQSNSSLVIGEAIVLK
LVRKVAHGVHPEAEMSRHLTRIGYQNTAALAGEVVHVDPDGRPHTVAILQRFVDNQGDAW
TRSFDFLKRAVDELALPAADDVDTVEPDAETDALLGYAAFAGVVGKRLGELHVALAQPSD
DPAFAPERATPEHVDGWCADAIASFEQALDCLGTRLDALDADTRAAAERLLASRDAAVRA
LGELVPRTLDAHCTRIHGDFHLGQVLDVQGDALLIDFEGEPARALERRRAKSHPLRDVAG
FLRSLSYVSATGQFAIEKAPPQAADRKRALFERFGRAAADAFVDCYRAAAEHAPVRFVDP
RYTDRLLALFLIDKASYELCYEAANRPDWLCVPVGGLAALVERLLEHRGAEDGDES
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgaagattccctcgacgacgtgcggcgcgcgcagttcgcgtcgcatccgcac
gccggctcgccgcgccagcgccgcgtgcgccggcccgcgcccgcgctctgcgccgacgat
ccgctgtggtacaaggacgcgatcatctaccaggtgcacgtgaagtcgttcttcgactcg
aacaacgacggcatcggcgacttccccggcctgatcgcgaagctcgactacatcgcggaa
ctcggcgtcgacgcgatctggctgctgccgttctatccgtcgccgcgccgcgacgacggc
tacgacatctccgactatcgcgacgtgcatcccgactacggcacgctcgccgacgtgcgc
cgcttcatccgcgaagcgcatgcgcgcggcattcgcgtgatcaccgagctcgtgatcaac
catacgtcggaccagcatccgtggttccagcgcgcgcggcgcgccaagccgggctcgatg
taccgcaactactacgtgtggtccgacaccgacacgaagtacgccggcacgcgcatcatc
tttctcgacaccgagacgtcgaactggacgcacgatccggtcgcgggccagtactactgg
catcgcttctactcgcaccagccggacctgaacttcgacaacccggccgtcgtgcgcgaa
gtgctgcaggtcatgcgcttctggctcgacctcggcatcgacgggctgcgcctcgacgcg
gtgccgtatctcgtcgagcgcgaaggcacgaacaacgagaacctgccggagacgcacgcg
atcctgaagcggatccgcgcgacgatcgacgccgagtatccgaaccgcatgctgctcgcc
gaagcgaaccagtggccggaggacgtgcaggaatacttcggcaacgaggacgaatgccac
atggcgttccactttccgctgatgccgcgcatctacatgtcgatcgcgagcgaggaccgc
tttccgatcatcgacatcatgcggcagacgccggcgctcgcgccgagcaaccagtgggcc
gtgttcctgcgcaatcacgacgagctcacgctcgagatggtcaccgattccgagcgcgac
ctgctctggcagacctacgcgagcgaccgccgcgcgcggctgaacctcgggatccggcgc
cggctcgcgccgctgatggagcgcgaccgccgccgcatcgagctgatcaactcgctgctg
ctgtccatgcccggcacgcccgtcatctactacggcgacgagatcggcatgggcgacaac
atccacctcggcgaccgcgacggcgtgcgcacgccgatgcagtggtcgtcggaccgcaac
ggcggcttctcgcgcgccgacccggaactgctcgtgctgccgcccgtcatgggctcgctg
tacggctatgacgcgatcaacgtcgaagcgcagacgcgcgacccgcactcgctgctgaac
tggacgcggcgcatcctcgcgacgcggcgcgcgacgcaggtgttcgggcgcggctcgatc
cgcttcctgcgtccggagaaccgcaaggtgctcgcctatctgcgcgaactcgaggggcac
gacccggtgctctgcgtcgcgaacctgtcgcgcgcgtcgcaggcggtcgaactcgacctg
tccgaattcgcgggccgcgtgccgatcgagatgacctcggactcgccgttcccgcccgtc
ggccagctcccgtatctgctcacctttccgccgtacggcttcctctggttcgtgctgtcc
gcgcacggccgcgagcccgcctggcggcagccgcatgcggaaccgctgcccgaatacgtg
acgctcgtgatgcggcgcggcgacacgcggcccgacgtcgcgcagctgcacacgctcgcg
cacgacgcgctcgcgtcgtggctcacgcggcggcgctggttcgcgtcgaaggaccgcacc
atcgccgacgcgcgcctgaacgtcgtcacgccgattccgggcgaatcgttccagtacgcc
gaagcctgcgtgacggtgcgcggcgacagccacgccgagcgctacgtggtgccgctcgcg
gtcgcgtggggcggcgagacctccggcccgctgttcgcgcagctcgcgctcgcgcgcgtg
cggcgcggccatacggtcggctatctgaccgacgcgttcgcgctgcccgccttcgcgcac
ggcatgctgcgcaagctgcgcgcgggcgcgacggtgccgacgtccgacggcggccatctc
gcgttcctgcccgaggccgcgctcgcgtcgctcgaccccggcgacgaggccgaagtgcgc
tggctcgcggccgagcagagcaacagctcgctcgtgatcggcgaagcgatcgtgctgaag
ctcgtgcgcaaggtcgcgcacggcgtgcatcccgaagcggagatgagccggcatctgacg
cgcatcggctaccagaacaccgccgcgctcgccggcgaagtcgtgcacgtcgatccggac
gggcgcccgcatacggtcgcgatcctgcagcgcttcgtcgacaaccagggcgatgcgtgg
acgcgttcgttcgacttcctgaagcgcgccgtcgacgagctcgcgctgccggccgccgac
gacgtcgacaccgtcgaaccggacgccgagacggacgcgctgctcggctatgcggcgttc
gccggtgtcgtcggcaagcggctcggcgagctgcacgtcgcgctcgcgcagccgtccgac
gatccggcgttcgcgcccgagcgcgcgacgcccgagcacgtcgacggctggtgcgccgac
gcgatcgcgtcgttcgagcaggcgctcgactgtctcggcacgcggctcgatgcactcgac
gccgacacgcgcgcggccgccgaacggctgctcgcgtcgcgcgacgcggccgtgcgcgcg
ctcggcgaactcgtgccgcgcacgctcgatgcgcactgcacgcgcattcacggcgacttc
catctcgggcaggtgctcgacgtgcagggcgacgcgctgctgatcgatttcgaaggcgag
cccgcgcgcgcgctcgagcggcgccgcgcgaagtcgcacccgctgcgcgatgtggccggc
ttcctgcgctcgctgtcgtacgtgagcgcgaccgggcagttcgcgatcgagaaagcgccg
ccgcaggcggccgaccgcaagcgtgcactgttcgagcgcttcggccgcgcggccgccgac
gcgttcgtcgactgctatcgcgcagccgccgagcatgcgccggtgcgcttcgtcgatccg
cgctacaccgaccggctgctcgcgctgttcctcatcgacaaggcgtcgtacgagctctgc
tacgaggccgcgaaccgtcccgactggctctgcgtgccggtcggcggcctcgcggcgctc
gtcgagcggctgctcgaacatcgcggcgccgaagacggagacgagtcatga

DBGET integrated database retrieval system