KEGG   Burkholderia multivorans DDS 15A-1: DM80_1445
Entry
DM80_1445         CDS       T03292                                 

Gene name
bphB
Definition
(GenBank) cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
  KO
K14582  cis-1,2-dihydro-1,2-dihydroxynaphthalene/dibenzothiophene dihydrodiol dehydrogenase [EC:1.3.1.29 1.3.1.60]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk00624  Polycyclic aromatic hydrocarbon degradation
bmk00626  Naphthalene degradation
bmk01100  Metabolic pathways
bmk01120  Microbial metabolism in diverse environments
bmk01220  Degradation of aromatic compounds
Module
bmk_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    DM80_1445 (bphB)
   00624 Polycyclic aromatic hydrocarbon degradation
    DM80_1445 (bphB)
Enzymes [BR:bmk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.29  cis-1,2-dihydro-1,2-dihydroxynaphthalene dehydrogenase
     DM80_1445 (bphB)
    1.3.1.60  dibenzothiophene dihydrodiol dehydrogenase
     DM80_1445 (bphB)
SSDB
Motif
Pfam: adh_short_C2 adh_short NmrA NAD_binding_10 Epimerase KR GDP_Man_Dehyd RmlD_sub_bind
Other DBs
NCBI-ProteinID: AIO77002
LinkDB
Position
1:1569526..1570305
AA seq 259 aa
MSTQQVIAITGAGSGIGFELVRSFKAAGYRVSALVRNEEQEAGLRSEFKDDIEIVAGDVR
DHATNEKLVKQTVAKFGRLDCFIGNAGIWDYMLSIDEPWEKFSGSFDEIFDINVKSYLSG
ISAALPELKKTNGSVVVTASVSSYAVGAGGSCYIASKHAVLGMVKALAYELAPHIRVNGV
APGGTVTSLAGPASAGFDKTKMKDMPGIDDMIKGLTPLGFAARPEDVVAPYLLLASREQG
KFITGTVIGIDGGMALGRK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagcacacagcaagttattgccatcactggcgccggctcgggcattggtttcgagttg
gttcgctcttttaaggcagccggttatcgcgtatctgcactcgttcgcaacgaggagcaa
gaggcgggtcttcgcagtgaattcaaagacgacattgagatcgtggcgggcgatgtccgt
gatcacgccaccaatgagaagctggttaaacagacggttgccaagttcgggcgcctggat
tgcttcatcggaaatgccgggatatgggattacatgctgagcatcgatgagccttgggag
aaattctcgggcagtttcgacgagatatttgacatcaacgtcaaaagctatttgagcggc
atcagcgcggccttgccggagctcaaaaagacgaacggatcggtggtggtgacggcttcc
gtttcttcctatgcggtcggtgccggcggttcttgctacattgccagcaaacatgcggtg
ctgggcatggtcaaggctttggcctacgaattggctccgcacatccgggtcaatggcgtt
gcgccaggtggcacggtcacttctttggctggcccggcaagcgctggcttcgacaaaacc
aaaatgaaagacatgcccggcatcgatgacatgatcaagggcctgacccccttggggttc
gcagcaaggcccgaggacgtggtggcaccgtatcttttgctggcctcccgggaacaaggg
aagttcatcactggcaccgtaatcggcattgatggcggcatggctctcggccgaaagtga

DBGET integrated database retrieval system