KEGG   Burkholderia multivorans DDS 15A-1: DM80_1446
Entry
DM80_1446         CDS       T03292                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00152  salicylaldehyde dehydrogenase [EC:1.2.1.65]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk00626  Naphthalene degradation
bmk01100  Metabolic pathways
bmk01120  Microbial metabolism in diverse environments
bmk01220  Degradation of aromatic compounds
Module
bmk_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    DM80_1446
Enzymes [BR:bmk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.65  salicylaldehyde dehydrogenase
     DM80_1446
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AIO75760
LinkDB
Position
1:1570354..1571805
AA seq 483 aa
MKTKLFINNTWSDSSDKKSFDRKHPVSGEVVTQCANATVDDAVNAARAAQEAFKSWKAVG
PSERRRLLLKVADVMESKTPEFIEVMAKEVGASALWAGFNVHLSANVFREAASLATQIQG
ETIPTDKPDTLSMTLRQPVGPILSIVPWNGTAVLAARAIAYPLVCGNTVVFKGSEFSPGT
HALITKCLQEAGLPAGVLNYLNSSPDRSPDIADALISSKEIRRINFTGSTRVGRIIAQKA
AQHLKRCLLELGGKSPLIVLDDADIDAAVKAAVFGSFLFQGQICMSTERLVVDEKIADEF
VAKFVEKTKQLSAGDPCVTGDCIIGPMVSPNSGDRINGLFKDAIDKGAKVVCGGIAEGAV
MPATILDHVTADMQIYDEETFGPITVVIRCKSEADAIRIANDSAYGLSSGVFGRDVNRAL
RVGMAIEYGSVHINGSTVQNEAQAPYGGTKATGYGRFDGRAVIDEFTELKWLTIEPFEQQ
YPF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaagacgaaattgtttatcaacaacacctggagcgattcgagtgacaaaaagtcattt
gatcgcaagcaccctgtcagtggcgaggtcgtgacccaatgcgcgaacgccacggtggac
gatgcggtcaatgcggctcgagccgctcaagaggcgttcaaatcttggaaggccgttggg
ccttcggagcggcggcgccttcttttgaaggtggcagacgtcatggagagcaaaacgccc
gagttcatcgaagtgatggccaaggaagtgggagcctccgcgctgtgggcggggttcaac
gtgcacctgtcggccaatgtattccgggaagccgcctcactagccacccaaattcaaggc
gaaaccattccgacggacaagcctgacaccctgtcgatgacgctgcgtcagccggttggc
cccatcttgagcatcgttccctggaacggcaccgccgtgctcgcggcgcgggccatcgct
tatccgctggtctgcggcaataccgttgtgttcaaaggctccgagttcagccccggcacg
cacgctttgatcaccaagtgcctgcaggaggccggcctgcctgctggcgtgctcaattat
ctgaactcctccccggaccggtcgcccgatattgcagatgcgctgatttcgtctaaagag
attcgtcgcatcaacttcacgggctccactcgcgtggggcgcatcatcgcccagaaagcg
gcccaacatctcaagcgctgcttgctggagttgggtggcaagtccccgctgatcgttctg
gacgacgcggacatcgacgcggcggtcaaggcagcggtgtttggcagtttcctgttccaa
ggccagatctgcatgtccaccgaacgcctggtggtcgacgaaaagatcgcggacgaattt
gtcgcgaagttcgtcgagaaaaccaagcagttgagcgcaggcgatccatgcgtcacaggg
gactgcatcatcggcccgatggtgtcgcccaactcgggtgaccgaatcaatggtctgttc
aaagatgccatcgacaagggcgccaaggtcgtgtgcggcggcatcgccgagggtgcggtc
atgcccgccacgatcttggaccacgtgacagccgacatgcagatctacgatgaggaaacc
ttcggtcccatcactgtggttatccggtgcaagagcgaagcggacgccatccgcattgcc
aatgacagcgcctacggcctgtcatcgggcgtgtttggccgggacgtgaaccgggctctg
cgcgtgggcatggcgatcgaatacggctcggtccatatcaacgggtctaccgtgcagaac
gaggcgcaggcgccttatggcggcacaaaggccaccggttatggccgcttcgatggacgc
gcggtgatcgacgagttcacggaactcaagtggctgaccattgaaccattcgagcagcag
tatcccttctaa

DBGET integrated database retrieval system