KEGG   Burkholderia multivorans DDS 15A-1: DM80_1447
Entry
DM80_1447         CDS       T03292                                 

Gene name
doxG
Definition
(GenBank) 1,2-dihydroxynaphthalene dioxygenase
  KO
K14583  1,2-dihydroxynaphthalene dioxygenase [EC:1.13.11.56]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk00626  Naphthalene degradation
bmk01100  Metabolic pathways
bmk01120  Microbial metabolism in diverse environments
bmk01220  Degradation of aromatic compounds
Module
bmk_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    DM80_1447 (doxG)
Enzymes [BR:bmk01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.56  1,2-dihydroxynaphthalene dioxygenase
     DM80_1447 (doxG)
SSDB
Motif
Pfam: Glyoxalase
Other DBs
NCBI-ProteinID: AIO77531
LinkDB
Position
1:1571831..1572739
AA seq 302 aa
MNKPATVIELGYMGISVKDPAAWKSFAANMLGLQVLDEGDKDRFYLRMDNWHHRIVVHHN
GQDDLEYLGWRVAGQPEFEALGQKLVDAGYKVRVCDKAEAQERMVLGLMKTEDPGGNPTE
IFWGPRIDLNNPFHPGRPLHGKFLTGDQGLGHCFVRQNDVEAARKFYSLLGFRGDVEYRL
PLPNGMTAELTFMHCNARDHSIAFGAMPAAKRLIHLMIEYTHIEDLGCTHQLFTKEKIDI
ALQLGIHSNDKALTFYGATPSGWLIEPGWRGAPAIAESEYYVGDIFGHAIEATGYGLDVK
LS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaacaagccagcaactgtcattgaattggggtacatgggcatttcggtcaaggatccc
gcagcgtggaaatcctttgccgcaaacatgctgggacttcaagtcctcgatgagggtgac
aaggatcgcttctatctgcgaatggacaattggcaccaccggatcgtggttcatcacaac
ggtcaagatgaccttgaatacttaggctggcgtgtcgccggtcaaccggaattcgaggca
ttgggtcaaaagctcgtggacgcaggctacaaagtccgcgtgtgcgacaaagccgaagca
caagaacggatggtactgggcctgatgaagacagaagatccggggggcaacccgaccgag
attttctggggacctcggattgacctgaacaatcccttccaccccggtcgtcccttgcac
ggaaaatttctaaccggtgatcagggcctgggccactgcttcgtgcgtcagaacgatgtt
gaagcggcacgtaagttctatagcttgctgggatttcgtggagatgtcgagtaccgcctt
cctttgcccaacggcatgacggctgagttgacgttcatgcattgcaatgctcgcgatcat
tccatcgctttcggtgcaatgcctgcggccaagcgcctcattcatctgatgattgaatac
actcatatcgaagatttgggttgcacacaccagcttttcacgaaggaaaagattgacatt
gccttgcaattgggcatccattccaacgataaggcgctgacgttctacggggcaacacct
tccggctggctgatagaacctgggtggcgaggcgcccccgccattgctgaatcggaatat
tacgtcggcgacattttcggtcacgccatcgaggccaccggttatggattggacgtcaaa
ctgagctag

DBGET integrated database retrieval system