KEGG   Burkholderia multivorans DDS 15A-1: DM80_1864Help
Entry
DM80_1864         CDS       T03292                                 

Definition
(GenBank) amino acid permease family protein
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
bmk  Burkholderia multivorans DDS 15A-1
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DM80_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease
Motif
Other DBs
NCBI-ProteinID: AIO76060
UniProt: A0A2S9N1U2
LinkDB All DBs
Position
1:complement(2012845..2014245)
Genome map
AA seq 466 aa AA seqDB search
MSLFRKKNVDRMIAGAHAAGLKKALGAIDLTFLGIGAIIGTGIFVLTGTGAVQAGPALML
SFVIAAIACGLAALSYAEFASTIPVAGSIYTYSYATLGELVAWIIGWDLMLEYGLAASAV
SVGWSGYLQSLLQGFGLTLPTVLTAAPGAVPGVVTWFNLPAFLVMIVITTLLSIGIREST
RINNVMVFIKVSVVLLVIAVGLFHVTPANWKPFMPHGWNGVFGAAAVMFFAFIGFDAVSS
AAEEVKNPKRDLPIGIIASLAVCAVLYVTVAAVATGIVPSAQYASISHPISYALQVAGEK
WVAGFIDLGAVLGMLTVILVMSYGQTRIIFAMSRDGLLPGTLSRVHPRYATPFLTTWLVG
LFFGLIAALVPLNVLAELINIGTLAAFSMVSIAVLVLRRTHPHLPRAFRCPGVPVVPLLA
VAACVFLMVNLQPVTWIAFGVWLVIGLAVYFLYSRHHSKLARGHAE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtctctctttcgcaagaaaaacgtcgatcgcatgatcgccggcgcgcacgccgccgga
ctcaagaaggcgctcggcgcgatcgacctgaccttcctcggcatcggcgcgatcatcggc
accggcatcttcgtgctgaccggcaccggcgccgtgcaggccggccccgccctgatgctg
tcgttcgtgatcgccgcgatcgcctgcggcctcgccgcgctgtcgtacgcggagttcgcg
tcgacgatcccggtcgccggctcgatctacacgtattcgtatgcgacgctcggcgaactc
gtcgcgtggatcatcggctgggatctgatgctcgaatacgggctcgcggcatcggccgtg
tcggtcggctggtcgggctatctgcagtcgctgctgcagggcttcgggctcacgctgccg
accgtgctgaccgccgcgccgggcgcggtgccgggcgtcgtcacgtggttcaacctgccc
gccttcctcgtgatgatcgtgatcacgacgctgctgtcgatcgggatccgcgaatcgacg
cgcatcaacaacgtgatggtgttcatcaaggtctcggtcgtgctgctcgtgatcgcggtc
ggcctgttccacgtgacgcccgcgaactggaagccgttcatgccgcacggctggaacggc
gtgttcggcgcggccgccgtgatgttcttcgcgttcatcggcttcgatgcggtgtcgtcc
gcggccgaggaagtgaagaatccgaagcgcgacctgccgatcggcatcatcgcgtcgctc
gcggtgtgcgcggtgctctacgtgacggttgcggcagtcgcgaccggcatcgtgccgtcc
gcgcagtacgcgagcatctcgcacccgatctcgtacgcgctgcaggtcgccggcgagaag
tgggtcgccggcttcatcgatctcggcgcggtgctcggcatgctgaccgtgattctcgtg
atgagctacgggcagacgcggatcatcttcgcgatgtcgcgcgacgggctgctgccgggc
acgctgtcgcgcgtgcatccgcgttacgcgacgccgttcctgacgacctggctcgtcggc
ctgttcttcggcctgatcgccgcgctcgtgccgctgaacgtactcgcggagctgatcaac
atcggcacgctcgccgcgttctcgatggtgtcgatcgccgtgctcgtgctgcgccgcacg
cacccgcacctgccgcgcgcgttccgctgcccgggcgtgccggtggtgccgctgctcgcg
gtcgcggcgtgcgtgttcctgatggtgaacctgcagccggtcacctggatcgcgttcggc
gtgtggctcgtgatcggtctcgccgtctatttcctctattcgcgacaccattcgaagctc
gcccgcggccacgcggagtga

DBGET integrated database retrieval system