Burkholderia multivorans DDS 15A-1: DM80_2573 Help Entry DM80_2573         CDS       T03292                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bmk  Burkholderia multivorans DDS 15A-1 Pathway bmk00261   Monobactam biosynthesis bmk01100   Metabolic pathways bmk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DM80_2573  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bmk01008]     DM80_2573 Polyketide biosynthesis proteins [BR:bmk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DM80_2573 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIO77218 LinkDB All DBs Position 1:2784851..2785063 Genome browser AA seq 70 aa AA seqDB search MNEIESQRYEVVANHEGQYSIWPTSREIPSGWKKAEFGGTREQCLDYIRGVWTDMRPLSV RQAMVGEAGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgaatgaaatcgaaagccagcgctacgaggtcgtggcgaatcacgaggggcagtattcg atctggccgacttccagggagatcccgtctggctggaaaaaggccgaattcggcggcacg cgggaacaatgtctcgactacatccgcggcgtctggaccgacatgcgtccgctgagcgtg cgccaggcgatggtaggcgaggcgggcgcgtga

DBGET integrated database retrieval system