KEGG   Burkholderia multivorans DDS 15A-1: DM80_2937Help
Entry
DM80_2937         CDS       T03292                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk00473  D-Alanine metabolism
bmk01100  Metabolic pathways
bmk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DM80_2937 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    DM80_2937 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmk01011]
    DM80_2937 (alr)
Enzymes [BR:bmk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DM80_2937 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bmk01011]
 Precursor biosynthesis
  Racemase
   DM80_2937 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIO74651
UniProt: A0A1W0ZTJ8
LinkDB All DBs
Position
1:3164576..3165646
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRYAGPSKVWAVVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTTVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYAPEKYRAAWERARACPSIGQITLMTHFSDADNERGVAEQLATFERGA
ANIAGARCLANSAAVLWHPDTHFDWVRPGIVLYGASPSGLSSDIADTGLKPAMTLSSELI
AVQSIGKGQAIGYGSTFAAPAPMRIGVVACGYADGYPRVAPEGTPVIVDGIRTRIVGRVS
MDMITVDLTPCPQAGVGARVELWGNALSIDDVARHCGTIGYELMCAVAARVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatctccgccaccatccacaccgccgctctcgcgaacaatctctccgtc
gtccgccgctatgccggcccgtccaaagtctgggcggtcgtcaaggccaatgcgtacggc
cacgggctcgcgcgcgtgttcccgggcctgcgcggcaccgacggcttcgggctgctcgat
ctcgacgaagccgtgaagctgcgcgagctcggctgggcgggcccgatcctgctgctcgaa
ggcttcttccgctcgaccgacatcgacgtcatcgatcgctatagcctgacgaccaccgtg
cacaacgacgagcagatgcggatgctggaaaccgcgcggctgtcgaagcccgtcaacgtg
cagctgaagatgaacagcggcatgaaccggctcggctacgcgccggagaaataccgcgcc
gcatgggagcgcgcccgcgcgtgtccgagcatcgggcagatcacgttgatgacccatttt
tcggatgccgacaacgagcgcggcgtcgccgagcagctcgcaaccttcgagcgcggcgcg
gcgaacatcgccggtgcgcgctgcctcgcgaattcggcggccgtgctgtggcatccggat
acgcatttcgactgggtgcggcccgggatcgtgctgtacggcgcgtcgccgtcggggctg
tcgtccgatatcgcggacaccgggctgaagccggcgatgacgctgtcgtccgagctgatc
gcggtgcagtcgatcggcaaggggcaggcgatcggctacggttcgacgttcgccgcgccg
gcgccgatgcggatcggcgtcgtcgcatgcgggtacgcggacggctatccgcgcgtcgcg
cccgaaggcacgccggtgatcgtcgacggcatccgcacgcgcattgtcgggcgcgtctcg
atggacatgatcacggtcgacctgaccccgtgtccgcaggccggcgtcggcgcgcgcgtc
gagctgtggggcaatgcgctgtcgatcgacgacgtcgcgcgccattgcgggacgatcggc
tacgagctcatgtgcgcggtcgcggcccgcgtgccggtgcgggcggaataa

DBGET integrated database retrieval system