KEGG   Burkholderia multivorans DDS 15A-1: DM80_2967Help
Entry
DM80_2967         CDS       T03292                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk00061  Fatty acid biosynthesis
bmk00780  Biotin metabolism
bmk01100  Metabolic pathways
bmk01212  Fatty acid metabolism
Module
bmk_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DM80_2967 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DM80_2967 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bmk01004]
    DM80_2967 (fabZ)
Enzymes [BR:bmk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     DM80_2967 (fabZ)
Lipid biosynthesis proteins [BR:bmk01004]
 Fatty acid synthase
  Component type
   DM80_2967 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AIO75051
UniProt: A0A1B4TY35
LinkDB All DBs
Position
1:3202501..3202968
Genome map
AA seq 155 aa AA seqDB search
MSTEKINLDIHKILTLLPHRYPILLVDRVLELEPHKGIKALKNVSINEPFFQGHFPKRPV
MPGVLILEALAQAAALLTFSEEQPKDPENTLYYFVGIDGARFKRVVEPGDQLILNVTFER
YIRGIWKFKAVAEVDGKVAAEAELMCTVKTADAAP
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaaaaatcaatctcgacatccacaagatcctcacgctgctgccgcatcgc
tatccgattctgctcgtcgaccgcgtgctcgaactcgaaccgcacaaaggcatcaaagcg
ctgaagaacgtgtcgatcaacgagccgttcttccagggccatttcccgaagcggccggtg
atgccgggcgtgctgatcctcgaggcgctcgcgcaggccgccgcactgctgacgttctcc
gaagagcagccgaaggatccggagaacacgctgtactacttcgtcggcatcgacggcgcg
cgcttcaagcgtgtcgtcgaaccgggcgaccagctgatcctgaacgtgacgttcgaacgc
tacatccgcgggatctggaagttcaaggcagtggccgaagtggacgggaaggttgcggcg
gaagccgagctgatgtgcacggtcaagacggccgacgcggcgccctga

DBGET integrated database retrieval system