KEGG   Burkholderia multivorans DDS 15A-1: DM80_3258Help
Entry
DM80_3258         CDS       T03292                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
Organism
bmk  Burkholderia multivorans DDS 15A-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AIO74572
LinkDB All DBs
Position
1:3500621..3502057
Genome map
AA seq 478 aa AA seqDB search
MKIYDQFYIDGAWRKPAGNGTIDVIDSGTEAVMGRIPEGLPADAQHAIRAARAAFEGWAA
TPAATRAGYLRRIAERLQARHEELAQSIVGEVGMPIKLSRAIQVGGPIYNWNAYAKLAES
FAFEAQVGHSLVVREPVGVVAAITPWNYPLNQITLKVAPALAAGCTVVLKPTEIAPLNAF
MLAEAIHEAGLPAGVFNLVCGYGPVVGEVLATDPDVDMVSFTGSTRAGKRVAELASASVK
RVALELGGKSASIILDDADFPAAVKGTVNACYLNAGQTCSAHTRMLVPQARYEEARALAK
AAAEAYVAGDPRLDTTRLGALASAAQQQRVLAYIQRGIDDGAELVTGGTGLPDGIDKGFF
VKPTVFGRVDPKSTIAQEEIFGPVLSIITYRDEDDAVRIANDSPYGLGGAVWAGSDERAL
RVARRLRTGQVDINGGAWNPAAPFGGFKQSGYGRENGVYGLDEYLEYKSLQLPAGKPA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctacgaccagttctatatcgacggcgcatggcgcaaaccggccggcaacggc
acgatcgacgtgatcgattccggcaccgaggccgtgatgggccggattccggaggggctg
cctgcggacgcgcagcacgcgatccgggcggcgcgcgccgcgttcgagggctgggcggcg
acgccggccgcgacgcgcgcgggctatctgcgccgcatcgccgagcgtctgcaggcgcgc
cacgaggaactggcgcagtcgatcgtcggcgaagtcgggatgccgatcaagctgtcgcgc
gcgatccaggtcggcggcccgatctacaactggaacgcgtacgcgaagctcgccgaatcg
ttcgcattcgaagcgcaggtcggccattcgctcgtcgtgcgcgagccggtcggtgtcgtc
gcggcgatcacgccgtggaattacccgctgaaccagatcacgctgaaagtcgcgccggcg
ctcgcggccggctgtacggtcgtgctgaagccgaccgaaatcgcgccgctcaacgcgttc
atgctggccgaagcgatccacgaagcggggctgccggccggcgtgttcaacctcgtgtgc
ggctacggccccgtcgtcggcgaggtgctcgcgaccgatcccgacgtcgacatggtgtcg
tttacgggctcgacgcgtgccggcaagcgcgtggccgaactcgcgtcggcgagcgtgaaa
cgcgtcgcgctcgaactgggcggcaagtcggcgtcgatcattctcgacgacgccgatttc
ccggcagccgtgaagggcaccgtcaacgcctgttatctgaacgccggccagacctgttcc
gcgcacacgcggatgctcgtgccgcaagcgcgctacgaagaggcgcgcgcgctcgcgaag
gcggcggccgaagcctacgtcgccggcgatccgcgcctcgacacgacgcgcctcggtgcg
ctcgcgtcggcggcgcaacagcaacgcgtgctcgcgtacatccagcgcgggatcgacgac
ggcgcagagctcgtgacgggcggcaccggcctgccggacggcatcgacaagggcttcttc
gtgaagccgaccgtgttcggccgcgtcgacccgaaatcgacgatcgcacaggaggagatc
ttcgggcccgtgctgtcgatcatcacgtaccgcgacgaggacgacgcggtgcgcatcgcg
aacgactcgccgtacggtctcggcggcgcggtatgggccggcagcgacgagcgcgcgctg
cgcgtcgcacgccggctgcgcacggggcaggtcgacatcaacggcggcgcgtggaatccg
gccgcgccgttcggcggcttcaagcagtcgggctacggccgcgagaacggcgtctacggt
ctcgacgaatatctcgagtacaagtcgctgcagctgcccgcgggcaagccggcctga

DBGET integrated database retrieval system