KEGG   Burkholderia multivorans DDS 15A-1: DM80_3661Help
Entry
DM80_3661         CDS       T03292                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM80_3661 (ahpF)
Enzymes [BR:bmk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DM80_3661 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_binding_3 HI0933_like Glutaredoxin K_oxygenase FAD_oxidored Thi4 DAO FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIO74212
LinkDB All DBs
Position
2:370357..371955
Genome map
AA seq 532 aa AA seqDB search
MLDANLKTQLKAYLEKITRPIELVASLDDSAKSQELRALLDEIASLTTRVTVIERRDDEA
RTPSFSIGEPGQPARIRFAGIPMGHEFTSLVLALLQTGGHPVKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQDEVEARQIMAVPTMFLNGES
FGQGRSSVKEILAKLDTGAGARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRAEALIPGDVHQ
IRLANGAVLKARTVVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKAVTLIEYGAQLRADEVLQRKLRSLPNVTVITEAQTTELTGDGSKL
NGLVYTDRRSGDVKKIELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDATPAVDTQPQADEAVAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagacccaactcaaagcgtacctcgaaaaaatcacgcgcccg
atcgaactcgtcgcatcgctcgacgacagcgcgaagtcgcaggaactgcgtgcgctgctc
gacgagattgcatcgctgacgacgcgcgtcaccgtgatcgaacgccgcgacgacgaggcg
cgcacgccgtcgttctcgatcggcgaaccgggccagcccgcgcggatccgcttcgcgggc
attccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccggtcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgacggcgactatgcg
ttcgagacgtacttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaatccgcgcatccgtcacgtcgcgatcgacggcgcgctgttccag
gacgaagtcgaagcacgccagatcatggcggtgccgacgatgttcctgaacggcgaatcg
ttcggccagggacgcagcagcgtgaaggaaatcctcgcgaagctcgatacgggcgccggc
gcacgcgcggcgaagtcgctcgagaacaagccggtgttcgacacgctgatcgtcggcggc
ggcccggccggtgcggcggccgcgatctactcggcgcgcaagggcatcgcgaccggcgtg
gtcgccgaacgtttcggcggccaagtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaaggaccgaagttcgcgactgcgctcgaacagcacgtgaagcagtac
gacgtcgacatcatggacgtacagcgcgccgaagcgctgattcccggcgacgtgcatcag
atccgcctcgcgaacggcgccgtgctgaaggccaggacggtcgtgctcgcgacgggcgcg
cgctggcgcgagatcaacgtgcccggcgaacgcgaataccgcaaccgcggcgtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtcgtcggcggcggc
aactcgggcgtcgaggccgcgatcgatctcgcgggcatcgtgaaggcagtcacgctgatc
gaatacggcgcgcagctgcgtgcggacgaagtgctgcaacgcaagctgcgcagcctgccg
aacgtgaccgtcatcaccgaagcgcagacgaccgagctcacgggcgacggcagcaagctg
aacgggctcgtgtatacggaccgtcgctcgggcgacgtgaagaagatcgaactcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacacggaatggctgaaggggacggtcgagctg
tcgaagcacggcgagatcgtcgtcgatgcacgcggcgcgacgtcggtgcccggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgcggtcggcgaaggc
gccaaggcgtcgctcggtgcattcgatcatctgatccgccaggacgcgacgccggctgtc
gacacgcaaccgcaagccgacgaagcggtcgccgcctga

DBGET integrated database retrieval system