KEGG   Burkholderia multivorans DDS 15A-1: DM80_4515Help
Entry
DM80_4515         CDS       T03292                                 

Definition
(GenBank) sugar (and other) transporter family protein
Organism
bmk  Burkholderia multivorans DDS 15A-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like LacY_symp Nuc_H_symport
Motif
Other DBs
NCBI-ProteinID: AIO74244
LinkDB All DBs
Position
2:1322960..1324270
Genome map
AA seq 436 aa AA seqDB search
MLFRSFPRPAWTYENRLLLILFMTFGFVFFDRLALSFLFPFMAAELHLTNAQLGMVSSAL
ALTWALSGAATGAWSDARGTRKPLLIAAVLGFSVCSALSGFVGGFASLIAFRALMGIAEG
PVLPLSQSLMIESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVVIGIATAAGWREAFYVSC
IPGIAIAFCLWRWVHETPPGGAIDARADACSAAKDTTKGATVSRWALLKARNVLLCVLIS
CFFLTWFVVVISFAPTFLVSSRHFSASDMGVVMTCLGAAWVFWGFAVPAISDRIGRKPTM
IVFALIAALCPLAMIHVASLWALCAFVFATYTGLGCFTLFMATIPAETVPPGAVASALGL
IMGAGELIGGFVAPTVAGFAADRFGLSFAMEMSAAGALVAGLLSIGLVETAPAVLRRRAL
ASAAARRFDTQNLGGR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgctattccgatcttttcctcgaccggcgtggacgtacgagaacaggttgctgctgatc
ctgttcatgacgttcggcttcgtcttcttcgaccgcctcgcgctgtcgttcctgtttcca
ttcatggcggccgaactgcatttgaccaatgcgcagctcggcatggtgtcgtccgcgctt
gcgctcacgtgggcgctgtccggcgccgcgacgggcgcgtggtccgacgcgcgcggcaca
cgcaagccgctgttgatcgcggccgtgctcggcttctccgtgtgctccgcgctgtcgggc
ttcgtcggcggcttcgcgagcctgatcgcattccgcgcgctgatgggcatcgccgaaggg
cccgtcctgccgctgtcgcagtcgctgatgatcgagagttcgacgccgagccgtcgcggg
ctgaacatgggcctgctgcaagggtccgccgcgggcctgctcggcgcgatgatcggtccg
ccggtcgtgatcggcatcgcgaccgcggccggctggcgcgaagcgttctacgtgtcgtgc
attcccggcatcgcgatcgcgttctgcctctggcgctgggtgcacgagacaccgccgggc
ggcgcgatcgacgcgcgcgcagatgcgtgcagcgcggcgaaggacacgacgaagggcgcg
acggtcagccgctgggcgctgctgaaggcgcgcaacgtcctgctgtgcgtgctgatcagc
tgctttttcctcacgtggttcgtcgtcgtgatctcgttcgcaccgacattcctcgtgagc
agccgtcatttttccgcatccgacatgggcgtcgtgatgacatgcctcggtgccgcctgg
gtgttctggggtttcgcggtgcccgcgatctcggaccgcatcggccgcaagccgacgatg
atcgtgttcgcgctgatcgccgcactgtgcccgctcgcgatgattcacgtcgcgtcgctc
tgggcgctctgcgcgttcgtattcgcgacctatacgggcctcggttgcttcacgctcttc
atggcgacgattccggccgagacggtgccgcccggcgcggtcgccagtgcgctgggcctc
atcatgggcgcgggcgagttgatcggcggtttcgtcgcgcccaccgtcgcgggcttcgcc
gcggaccgcttcgggctgtcgttcgcgatggagatgtcggccgcaggcgcactcgtcgcc
ggcctgctgtcgatcggcctcgtcgaaacggcgcccgcggtattgcgcaggcgcgcgctt
gcgagcgccgccgcgcgccgtttcgatacgcaaaacctcggaggacgctga

DBGET integrated database retrieval system