KEGG   Burkholderia multivorans DDS 15A-1: DM80_4517Help
Entry
DM80_4517         CDS       T03292                                 

Definition
(GenBank) short chain dehydrogenase family protein
Organism
bmk  Burkholderia multivorans DDS 15A-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR Glyco_trans_4_4 Glyco_transf_4 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AIO72295
LinkDB All DBs
Position
2:1325371..1326093
Genome map
AA seq 240 aa AA seqDB search
MSQAQTFERKTVVVTGGTSGIGAHTALRFAEAGASVVSIGLQAAGPHAPVHERIRHVELN
VADSDALTRTIGALPRIDVLVNGVGISRHADEYRMDEFEHVLNVNLTSVMRASDAARPAL
SVEGGAIVNIASMYTYFGSKDRPAYSASKGGIAQLTRSLAQAWADRGIRVNAVAPGWIDT
PLSSALMADAQASRRILERTPLGRWGKPDEVADVILFLCSPGASFVTGAIVPVDGGYSTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagcgcagacgtttgagcgcaagaccgtcgtcgtgacgggcggtacatcggga
atcggcgcacataccgcactgcgcttcgcggaagcgggcgcgtcggtcgtcagcatcggg
ctgcaggccgcgggcccgcatgcgccggtgcacgagcgcattcggcatgtcgagctcaac
gtcgccgacagcgacgcgctgacgcgtacgatcggcgccctgccgcgcatcgacgtgctc
gtcaacggcgtcggcatcagccggcacgcggacgaatatcggatggacgaattcgagcac
gtgctgaacgtgaatctgacgtcggtgatgcgggcgtcggacgccgcgcgcccggcgctg
tccgtggaaggcggcgcgatcgtcaacatcgcgtcgatgtacacgtatttcggcagcaag
gaccgaccggcgtatagcgccagcaaaggcgggatcgcgcagctcacgcgttcgctcgcg
caggcctgggccgaccgcggcattcgcgtcaatgcggtcgcgccgggctggatcgatacg
ccgctcagcagcgccttgatggccgatgcgcaggcgtcgcgtcgaatcctcgagcgcacg
ccgctcgggcgatggggcaagcccgacgaagtcgccgacgtgatcctgtttctctgctcg
cccggcgcgtcgttcgtgaccggtgcgatcgttcccgtcgacggcggctattcgacggtc
tga

DBGET integrated database retrieval system