KEGG   Burkholderia multivorans DDS 15A-1: DM80_4565
Entry
DM80_4565         CDS       T03292                                 

Definition
(GenBank) toluene tolerance, Ttg2 family protein
  KO
K07323  phospholipid transport system substrate-binding protein
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DM80_4565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmk02000]
    DM80_4565
Transporters [BR:bmk02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Phospholipid transporter
    DM80_4565
SSDB
Motif
Pfam: MlaC
Other DBs
NCBI-ProteinID: AIO72244
UniProt: A0A1W0YHR2
LinkDB
Position
2:1386854..1387450
AA seq 198 aa
MKRHLFAFLAAAAVSVSAFAQSAPVDIVRHAVEGTVNAMKADPAARGGDMAKITQVVEQR
FLPATNFERTTRIAVGDAWKQATPQQQQELYKQFRLLMTRTYAASLAQLGNQDAKFSFKA
GGTSGADALVQSTVTTPGDSQSVGYRLGKVGNDWKIYDIDMSGAWLIQVYQGQFKSQLAS
GGIDGLIAYLQKHNSRTN
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaaacgtcatctgtttgctttcctcgccgcggccgccgtgtcggtttccgctttcgcg
cagagcgcgccggtcgacatcgtccgccatgcggtcgaaggtaccgtcaacgcgatgaag
gccgatccggccgcgcgcggcggcgacatggcaaagatcacgcaggtcgtcgagcagcgc
ttcctgccggcgacgaacttcgagcgcacgacgcgcatcgcggtcggcgacgcgtggaag
caggcgacgccgcaacagcagcaggagctctacaagcagttccggctgctgatgacgcgc
acgtacgcagcgtcgctcgcgcagctcggcaaccaggacgcgaagttctcgttcaaggcg
ggcggcacgtcgggcgccgacgcgctcgtgcagtcgacggtcacgacgccgggcgacagc
cagtcggtcggctaccggctcggcaaggtcggcaacgactggaagatctacgacatcgac
atgtccggtgcgtggctgatccaggtctatcaggggcagttcaagagccagcttgcgtcg
ggcggcatcgacggcctgatcgcgtatctgcagaagcacaattcccgcacgaactga

DBGET integrated database retrieval system