KEGG   Burkholderia multivorans DDS 15A-1: DM80_4566
Entry
DM80_4566         CDS       T03292                                 

Definition
(GenBank) bacterial regulatory s, luxR family protein
  KO
K07684  two-component system, NarL family, nitrate/nitrite response regulator NarL
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM80_4566
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bmk02022]
    DM80_4566
Two-component system [BR:bmk02022]
 NarL family
  NarX-NarL (nitrate respiration)
   DM80_4566
SSDB
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_29 HTH_24 HTH_23 HTH_20 HTH_40 Sigma70_r4 HTH_11 HTH_38 HTH_28 HTH_Tnp_ISL3 HTH_36
Other DBs
NCBI-ProteinID: AIO73234
UniProt: A0A1B4MYW4
LinkDB
Position
2:complement(1387624..1388268)
AA seq 214 aa
MSAPDTARPAARLLLVDDHPLVRDGLRMRLEAADLSVVGEAGNADEALALAAELEPDLAL
MDVGMNGMNGIALAGVFHERFPAIRVLMLSMHDNVEYVTQAVRAGASGYLLKDSPASEIV
RAIGAVLAGQTFFSEGLAARMIQASAAASPLDRLTPRERDILDALAEGLSSKQIAQQTGL
SVRTVETHRLNLKRKLDIEGQAELIKFAVEHRRR
NT seq 645 nt   +upstreamnt  +downstreamnt
atgagcgcccccgacaccgcccgacccgccgcccggctgctgctcgtcgacgatcacccg
ctcgtgcgcgacgggctgcgcatgcggctcgaagcggccgatctgtccgtggtcggcgaa
gccggcaacgccgacgaggcgcttgcgctcgcggccgaactcgagcccgatctcgcgctg
atggacgtcggcatgaacgggatgaacggcatcgcgctggccggcgtgttccacgagcgg
tttccggcgatccgcgtgctgatgctgtcgatgcacgacaacgtcgaatacgtgacgcaa
gccgtgcgggcgggcgcgagcggctatctgctgaaggattcgccggccagcgagatcgtc
cgcgcgatcggcgcggtgctcgcggggcaaaccttcttcagcgaggggcttgccgcacgg
atgatccaggcgagcgcggccgcgtcgccgctcgaccggctgacgccgcgcgaacgcgac
atcctcgatgcgctcgccgaagggctgtcgagcaagcagatcgcgcagcagacggggttg
tcggtgcgcacggtggaaacgcaccggctcaatctgaaacgcaagctcgacatcgaaggg
caggccgaactgatcaagttcgcggtcgagcatcggcggcgctag

DBGET integrated database retrieval system