KEGG   Burkholderia multivorans DDS 15A-1: DM80_4572
Entry
DM80_4572         CDS       T03292                                 

Definition
(GenBank) cheB methylesterase family protein
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk02020  Two-component system
bmk02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM80_4572
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    DM80_4572
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bmk02022]
    DM80_4572
   02035 Bacterial motility proteins [BR:bmk02035]
    DM80_4572
Enzymes [BR:bmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DM80_4572
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     DM80_4572
Two-component system [BR:bmk02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   DM80_4572
Bacterial motility proteins [BR:bmk02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DM80_4572
SSDB
Motif
Pfam: CheB_methylest
Other DBs
NCBI-ProteinID: AIO72880
UniProt: A0A2S9MUL7
LinkDB
Position
2:complement(1396537..1397541)
AA seq 334 aa
MDHRDVVVVASSRGGLPVLRTLVTNLPEGFPVPICIVQHIGRNRSILPELLTRWGRLDAT
HALHGERPHPGRIYVAPPDRHLVLRGGRLHLLDTAAENYARPAADPLFRSAAREYGPGAI
GVVLSGDLDDGSAGLAAIRAHGGYGIVQRPDECEAPSMPRAALAAAGADAVATADELART
IHAAVYGARGEEGRTMTDLRTLDDESRIAEGRFVTPQLLDAIGERSALTCPSCNGALWRM
RDDRPLRYRCHTGHAFSALSLDDAEAQKAEDAIWVAIRAVNERMIFARERQEWARRTGNA
EDEAIEQARIDENRQLAEVLRHALHVATHGRETG
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggaccatcgagatgtcgtcgtcgtcgcgtcgtcgagaggcggactgccggtactccgg
acgctcgtgaccaacctgcccgagggcttccccgtcccgatctgcatcgtgcagcacatc
ggccggaaccggtcgattctgccggaactgctgacgcgctggggcaggctggacgcgacc
cacgcgttacacggagagcgcccgcatccgggcagaatttatgtcgcgccgcccgaccgg
catctcgtgctgcgcggcggcaggctgcatctgctcgatacggctgccgaaaactacgcg
cgtcccgccgccgatccgctgttccgctccgccgcgcgcgaatacgggccgggcgcgatc
ggcgtcgtgctgagcggcgatctcgacgacggatccgcgggcctcgcggcgatccgcgcc
cacggcggctacggcatcgtccagcgtccggacgaatgcgaggcgccgtcgatgccgcgc
gccgcgctggccgctgcgggcgcggacgccgtggcgacggccgacgaactggcgcgcacg
attcatgcggcggtctatggcgcacgcggcgaggagggtcgcacgatgacggatttgcgc
acactggacgacgaaagccgaatcgccgagggccgcttcgtcacgccccaattgctcgat
gcgatcggcgagcgctcggcgctcacgtgcccgagctgcaacggcgcgctatggcgcatg
cgcgacgatcgcccgttgcgctatcggtgccataccgggcacgcattctcggcgctttcg
ctcgacgatgcggaagcgcagaaggcggaagatgcaatctgggtcgcgatccgcgccgtc
aacgagcgaatgatcttcgcgcgcgagcggcaggagtgggcgcgccgcacgggcaacgcg
gaagacgaggcgatcgagcaggcacgcatcgacgaaaaccggcagctcgcagaggtgctg
cgccatgcgctgcatgtggcaacgcatggccgcgagaccgggtga

DBGET integrated database retrieval system