KEGG   Burkholderia multivorans DDS 15A-1: DM80_4743Help
Entry
DM80_4743         CDS       T03292                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk00250  Alanine, aspartate and glutamate metabolism
bmk00410  beta-Alanine metabolism
bmk00640  Propanoate metabolism
bmk00650  Butanoate metabolism
bmk01100  Metabolic pathways
bmk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DM80_4743 (gabT)
   00650 Butanoate metabolism
    DM80_4743 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DM80_4743 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DM80_4743 (gabT)
Enzymes [BR:bmk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DM80_4743 (gabT)
Amino acid related enzymes [BR:bmk01007]
 Aminotransferase (transaminase)
  Class III
   DM80_4743 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIO72598
UniProt: A0A2P1Y966
LinkDB All DBs
Position
2:complement(1596824..1598107)
Genome map
AA seq 427 aa AA seqDB search
MKNADLLARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIAEQLDLFTHTAYQIVPYASYVELAEKINERAPGDFPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVTTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIADEV
QTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASAHAVLEIIDEEKLCERATQLGDTLKAKLNALQAEVPQIADVRGPGAMIAVEFMK
PGTGEPDAEFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALAILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgctggcccgcaagaacgccgcgaccccgcgcggcgtcggagtg
atgtgcgacttctacgccgcccgcgccgagaacgcggagctgtgggacgtcgaaggccgc
cgtttcatcgatttcgccgcgggcatcgcggtgctgaacacgggccatcgtcatccgaag
atcgtcaaggcgatcgcggagcagctcgacctcttcacgcacaccgcctaccagatcgtc
ccgtacgcgtcgtacgtcgagctggccgaaaagatcaacgaacgcgcgccgggcgacttc
ccgaaaaagacggcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatcaagatc
gcacgcgcggcaaccggccgtccgggcgtgatcgcgttctcgggcggcttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttcggtccg
ttcccgggcgacgtgttccacgcaccgtacccgaacgccgtgcacggcgtgacgaccgcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggccgagttc
gtgcgcgcgctgcgcaagatctgtaacgagcacggcatcctgctgatcgccgacgaagtg
cagacgggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgacgtgctggcc
gatctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtcgtcggc
cgtgcggacgtgatggacgcggccgcgccgggcggcctcggcggcacgtacgcgggcaac
ccgctcgcggtcgcgtcggcgcacgcagtgctcgagatcatcgacgaagaaaagctgtgc
gagcgcgcgacgcagctcggcgacacgctgaaggcgaagctgaacgcgctgcaggccgag
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttcatgaag
ccgggcaccggcgagccggacgccgaattcacgaagcgcgtgcaggcgcgtgcgctcgag
cgcgggctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgatcccgcaagccgtgttcgacgaagcgctcgcgatcctcgaggaagtgctgaag
gaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system