KEGG   Burkholderia multivorans DDS 15A-1: DM80_4958Help
Entry
DM80_4958         CDS       T03292                                 

Definition
(GenBank) major Facilitator Superfamily protein
Organism
bmk  Burkholderia multivorans DDS 15A-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_3 MFS_1 MFS_2 FUSC-like
Motif
Other DBs
NCBI-ProteinID: AIO72983
LinkDB All DBs
Position
2:1853156..1854406
Genome map
AA seq 416 aa AA seqDB search
MTAPLPDARTASELPANLFRHAPFRRFWGTRVMSSLAFQILSVAIGWYVYALTHSAFALG
LVGLAQFVPMFALTLVVGQVADRFDRRRIATICQSVEALASGVFLLGAAQGWLAAPGVYA
LAAIVGTARAFESPSVSSLLPAVVPRSELPRATALSTSANQAAQILGPAFGGLLYGLGAP
VAFGTSVAAFAIAALLSGTIPLRSAPPAREPVTLRSVFSGIAFIRREPAILGALSLDLFA
VLFGGATALLPIYARDILQVGPWGLGALRAAPAVGALAGTLWLTRFPLKARPGRAMFGGV
IAFGIATIVFGLSRHVALSLVALAALGASDVISVVVRLSLVQLRTPDDMLGRVSAVNALF
IGTSNQLGEFESGVTAAWWGAPAAIVVGGAATIAVALAWMRLFPTLRNMTSLERDR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccgttgcccgacgcccgcaccgcttccgaactgcccgccaatctgtttcgt
cacgctccgttccgacggttctggggcacgcgcgtgatgtcgtcgctggctttccagatc
ctgtcggtcgcgatcggctggtacgtgtacgcgctcacgcacagcgcgttcgcgctcggc
ctcgtcggcctcgcgcagttcgtgccgatgttcgcgctgacgcttgtcgtcgggcaggtc
gccgaccgcttcgaccggcggcgcatcgcgacgatctgccagagcgtggaagcgctggcg
tccggcgtgtttctgctcggcgccgcgcaaggatggctcgccgcgccgggcgtctatgcg
ctcgcggcgatcgtcggcaccgcgcgcgcattcgagtcgccgtcggtctcgtcgctgctg
ccggccgtcgtgccgcgctccgagttgccgcgtgcaaccgcgttgtcgacgtccgcaaat
caggccgcgcagattctcgggccggcatttggcgggctgttgtacgggctcggtgcgccg
gtcgcgttcggcacgagcgtcgccgcgttcgcgatcgccgcgctgctgagcggcacgatt
ccgctgcgcagcgcgccgccggcgcgcgagcccgtgacgctgcgctcggtgttttccggc
atcgcgttcatccggcgcgagccggcgatactcggcgcgttgtcgctcgatctgttcgcg
gtgctgttcggcggtgctaccgcgctgttgccgatctatgcacgcgacatcctccaggtc
gggccgtgggggctcggcgcgttgcgcgcggcgcccgcggtcggcgcgctcgcgggcacg
ctctggctcacgcgttttccgttgaaggcgcggcccggccgcgcgatgttcggcggcgtg
atcgcattcggcatcgcgacgatcgtgttcggcctgtcgcggcatgtcgcgttgtcgctt
gtcgcgctcgcggcgctcggcgcgtccgacgtcatcagcgtggtcgtgcggctctcgctc
gtgcagctgcgcacgcccgacgacatgctcggccgcgtcagcgccgtcaatgcgctgttc
atcggcacgtcgaaccagctcggcgaattcgaatcgggcgtcacggccgcgtggtggggc
gcgcccgcggcgatcgtcgtcggcggcgcggccacgatcgcggtcgcgctcgcgtggatg
cggctctttccgacgctgcgcaacatgacgtcgctcgaacgcgatcggtga

DBGET integrated database retrieval system