KEGG   Burkholderia multivorans DDS 15A-1: DM80_5418Help
Entry
DM80_5418         CDS       T03292                                 

Definition
(GenBank) transglutaminase-like superfamily protein
Organism
bmk  Burkholderia multivorans DDS 15A-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2126 Bact_transglu_N Transglut_core
Motif
Other DBs
NCBI-ProteinID: AIO73889
LinkDB All DBs
Position
2:2385031..2388468
Genome map
AA seq 1145 aa AA seqDB search
MPIHVALHHATRYRYDRLVNLGPQVVRLRPAPHCRTPIVAYSMTVEPARHFINWQQDPFS
NHLARLVFPERTDHFDITIDLVAEMSVYNPFDFFLESSAEQYPFGYDEALKIELAPYLAC
DPQTSAAPAFRAYLDGVDRTPAGTVNFLVALNQRLQRDIRYLVRMEPGVQTPAQTLELGS
GSCRDSGWLLVQLCRHLGIAARFVSGYLIQLVPDQKSLDGPSGTSVDFTDLHAWCEVYLP
GAGWIGFDPTSGLLAGEGHIPLACTPQPTSAAPVDGLIDECEVAFEHEMTVTRVYESPRV
TKPYSDAQWQAVRALGTQVDGALAAGDVRLTQGGEPTFVSIDDRDGAEWNTDALGPTKRG
YATALVQRLRAEYGRGGFLHVGQGKWYPGEQLPRWAMSIFWRADGEPVWDDPSLFADERE
PSALSTADAKRFIDALAARLGLSGEFIRPGYEDVWYYLWRERRLPVNVDPFDSRVDDELE
RARLRKVFDQRLDSVVGYVLPIRRADGPPPLDGPRWQTGPWFFRDERMYLVPGDSPMGYR
LPLDSLPWVAAGDYPHLYERDPFAPAEALPDAAALRARYGGPAASADAGAGAAPRYVPGV
HREAPAQTVMQWRDDGKRGDAQDAQDADASRYPDRFESAAWVTRTALCAQVRDGILYLFM
PPLAALDDYLHLLAAIEATAQALGVKLVLEGYPPPRDARLKMLQVTPDPGVIEVNVHPAA
NFDDLVAQTEFLYDAAWQSRLSSEKFMVDGRHVGTGGGNHVVLGGATPADSPFLRRPDLL
ASLIAYWLNHPSLSYLFSGLFIGPTSQAPRVDEARNDQLYELDLAFAAIRRHVQGGEPTP
PWLVDRVLRNLLIDVTGNTHRSEFCIDKLYSPDSPTGRLGLLELRAFEMPPHARMSIVQQ
LLLRALIARFWAAPYTTPLTRWGTALHDRFMLPAFVKMDFDDVLNELRDSGFAFDAAWFA
PHFEFRFLLFGQIAVNGMQLTLRGALEPWHVMGEEGAVGGTVRYVDSSVERLEVRVTGLN
DNRHVVTVNGRALPLQPTGTAGEYVAGVRYKAWSPPSALHPTLGVDAPLTFDVVDTWLQR
SLGGCRYHVAHPGGRNYATFPVNAYEAESRRLARFVAMGHTPGRMDVAAPAPSREFPFTL
DLRRP
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgcccatccacgtcgcgctgcaccacgccacccgctatcgctacgaccggctcgtcaac
ctcggcccgcaggtcgtgcggctgcgtccggcgccgcactgccgcacgccgatcgtcgcg
tattcgatgacggtcgagcccgcccggcacttcatcaactggcagcaggacccgttctcg
aaccatcttgcgcggctcgtgtttcccgaacgcaccgaccatttcgacatcacgatcgat
ctcgtcgccgagatgtcggtgtacaacccgttcgacttcttcctcgaaagcagcgcggag
cagtatccgttcggctatgacgaggcgctgaagatcgaactcgcgccgtatctcgcctgc
gatccgcagacgagcgccgcgccggcgtttcgcgcgtatctcgacggcgtcgatcgcacg
ccggccggcaccgtgaatttcctggtcgcgctgaatcagcggctgcagcgcgacattcgc
tatctcgtgcggatggagcccggcgtgcagacgcccgcgcagacgctcgagctcggctcg
ggatcgtgccgcgacagcggctggctgctcgtgcagctgtgccggcatctcggcattgcc
gcgcgcttcgtgtccggctatctgatccagcttgtgccggaccagaagtcgctcgacggc
ccgagcggcacgtcggtcgatttcaccgacctgcatgcatggtgcgaggtctatctgccg
ggcgccggctggatcggcttcgatccgacgtcgggcctgctggccggcgaagggcacatt
ccgctcgcctgtacgccgcagccgacgagcgcggcgccggtcgacgggctgatcgacgaa
tgcgaggtcgcgttcgaacacgagatgaccgtcacgcgcgtgtacgaatcgccgcgcgtg
acgaagccgtattccgacgcgcagtggcaggcggtgcgcgcgctcggcacgcaggtcgac
ggtgcgctcgcggccggcgacgtgcggctcacgcagggcggcgagccgaccttcgtgtcg
atcgacgaccgcgacggcgccgaatggaacaccgacgcgctgggtccgaccaagcgcggc
tatgcgaccgcgctcgtgcagcggctgcgcgccgaatacggccgcggcggctttctgcat
gtcgggcagggcaagtggtatccgggcgagcagctgccgcgctgggcgatgtcgatcttc
tggcgcgcggacggcgagcccgtgtgggacgacccgtcgctgttcgcggacgaacgcgag
ccgtccgcgctgagcaccgccgacgcgaagcgcttcatcgacgcgctcgcggcacggctc
gggctgagcggcgagttcatccggcccggctacgaagacgtctggtattacctgtggcgc
gaacgccggctgcccgtcaacgtcgatccgttcgattcgcgcgtcgacgacgagctcgag
cgcgcgcggctgcgcaaggtgttcgaccagcggctcgacagcgtcgtcggctacgtgctg
ccgatccggcgcgcggacggcccgccgccgctcgacggtccgcgctggcagaccggcccg
tggttcttccgcgacgagcgcatgtatctggtgccgggcgattcgccgatgggctatcgg
ctgccgctcgattcgctgccgtgggtggcggccggcgactatccgcatctgtacgaacgc
gatccgttcgcgccggccgaggcattgcccgatgccgccgcattgcgcgcgcgctatggc
ggcccggccgcgtcggccgacgccggcgctggcgccgcgccgcgctacgtgccgggcgtg
catcgcgaagcgccggcgcagacggtgatgcagtggcgcgatgacggcaagcgcggcgac
gcgcaggacgcgcaggacgctgacgcatcgcgctaccccgaccgcttcgaatcggccgcc
tgggtcacgcgcaccgcgctctgcgcgcaggtgcgcgacggcatcctgtatctgttcatg
ccgccgctcgccgcgctcgacgattacctgcacctgctcgcggcaatcgaggcgaccgca
caggcgctcggcgtgaagctcgtgctcgaaggctatccgccgccgcgcgacgcgcggctg
aagatgctgcaggtgacgcccgatcccggcgtgatcgaggtgaacgttcatccggccgcg
aatttcgacgacctcgtcgcgcagaccgaattcctgtacgacgccgcgtggcagtcgcgg
ctttcgagcgagaagttcatggtcgacggccgccacgtcggcaccggcggcggcaaccac
gtcgtgctcggcggcgcgacgccggccgacagcccgttcctgcgccgccccgatctgctc
gcgagcctgatcgcgtactggctcaaccatccgtcgctgtcgtatctgttctcggggctt
ttcatcgggccgacgagccaggcgccgcgcgtcgacgaagcgcgcaacgatcagctctac
gagctcgacctcgcgttcgcggcgatccggcgtcacgtgcagggcggcgagccgacgcca
ccctggctcgtcgatcgcgtgctgcgcaacctgctgatcgacgtgaccggcaacacgcac
cgcagcgagttctgcatcgacaagctgtattcgcccgattcgccgacgggccggctcggc
ctgctcgaactgcgcgcgttcgagatgccgccgcatgcgcggatgagcatcgtgcagcaa
ctgctgctgcgcgcgctgatcgcccgcttctgggccgcgccgtatacgacgccgctcacg
cgctggggcaccgcgctgcatgatcgcttcatgctgccggccttcgtgaagatggacttc
gacgacgtgctgaacgagctgcgcgacagcggcttcgcgttcgacgccgcgtggttcgcg
ccgcacttcgagttccgcttcctgctgttcggccagatcgccgtgaacgggatgcagctg
acgctgcgcggcgcgctcgagccgtggcacgtgatgggcgaggagggcgcggtgggcggg
accgttcgctatgtcgattcgtcggtcgagcggctcgaagtgcgcgtgacggggctgaac
gacaaccggcacgtcgtgaccgtcaacggccgcgcgctgccgctgcagccgaccggtacg
gccggcgaatacgtcgcgggcgtgcgctacaaggcgtggtcgccgccgtcggcgctgcac
ccgacgctcggcgtcgatgcgccgctgacgttcgacgtcgtcgatacgtggctgcagcgc
tcgctcggcggctgccggtatcacgtcgcgcatccgggcgggcgcaactacgcgacgttt
ccggtcaatgcctacgaagccgaaagccgccggctcgcgcgtttcgtcgcgatgggacac
acgccggggcggatggacgtcgcggcgcccgcgccgagccgcgaattcccgttcacgctc
gatttgcggcggccctga

DBGET integrated database retrieval system