KEGG   Burkholderia mallei NCTC 10229: BMA10229_0128Help
Entry
BMA10229_0128     CDS       T00471                                 

Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00061  Fatty acid biosynthesis
bml00780  Biotin metabolism
bml01100  Metabolic pathways
bml01130  Biosynthesis of antibiotics
bml01212  Fatty acid metabolism
Module
bml_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BMA10229_0128
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BMA10229_0128
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BMA10229_0128
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bml01004]
    BMA10229_0128
Enzymes [BR:bml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BMA10229_0128
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BMA10229_0128
Lipid biosynthesis proteins [BR:bml01004]
 Fatty acid synthase
  Component type
   BMA10229_0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ABM98911
UniProt: A2RW85
LinkDB All DBs
Position
II:112648..113409
Genome map
AA seq 253 aa AA seqDB search
MRLQHKRGLIIGIANENSIAFGCARVMREQGAELALTYLNEKAEPYVRPLAQRLDSRLVV
PCDVREPGRLEDVFARIAQEWGQLDFVLHSIAYAPKEDLHRRVTDCSQAGFAMAMDVSCH
SFIRVARLAEPLMTNGGCLLTVTFYGAERAVEDYNLMGPVKAALEGSVRYLAAELGPRRI
RVHALSPGPLKTRAASGIDRFDALLERVRERTPGHRLVDIDDVGHVAAFLASDDAAALTG
NVEYIDGGYHVVG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttcagcacaagcgtggcctcatcatcggcattgcaaacgaaaacagcatcgcg
ttcggctgcgcgcgggtcatgcgcgagcagggcgccgagctcgcgctcacttacttgaac
gaaaaggccgagccctatgtccgtccgctcgcgcagcgtctggacagccggctcgtcgtg
ccgtgcgacgtgcgcgagcccggccggctcgaggacgtgttcgcgcgcatcgcgcaggaa
tgggggcagctcgacttcgtgctgcactcgatcgcatacgcgccgaaggaggacctgcat
cgccgcgtgaccgactgctcgcaggcgggcttcgcgatggcgatggacgtgtcgtgccat
tcgttcattcgcgtcgcgcgcctggccgagccgctgatgacgaacggcggctgcctgctg
accgtcacgttctacggtgccgagcgggctgtcgaggactacaacctgatgggcccggtg
aaggcggcgctcgagggctcggtgcgctatctcgccgccgagctcgggccgcggcgcatc
cgcgtgcacgcgctgtcgcccgggccgctgaagacgcgcgccgcgtccggcatcgaccgc
ttcgacgcgctgctcgaacgcgtgcgcgagcgcacgcccgggcatcgcctcgtcgacatc
gacgacgtcggccatgtcgccgcgttcctcgcgagcgacgatgcggccgcgctgacgggc
aacgtcgagtacatcgacggcggctatcacgtcgtcggctga

DBGET integrated database retrieval system