KEGG   Burkholderia mallei NCTC 10229: BMA10229_0308Help
Entry
BMA10229_0308     CDS       T00471                                 

Gene name
dhbF
Definition
(GenBank) nonribosomal peptide synthetase DhbF
  KO
K04780  nonribosomal peptide synthetase DhbF
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    BMA10229_0308 (dhbF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bml01008]
    BMA10229_0308 (dhbF)
Polyketide biosynthesis proteins [BR:bml01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Bacillibactin synthetase
    BMA10229_0308 (dhbF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABM99602
UniProt: A2RWR3
LinkDB All DBs
Position
II:302169..305417
Genome map
AA seq 1082 aa AA seqDB search
MQHIDTGLRLAMNMRDTSLRPLLPAQREIWLAEQLRPGTGVYNTAGYADIVGAVDHGALR
DAFGHAMREADAVRATFSAHGDDAWQTPRDAPHADVPLVDVSGQADPAGVALAWMMRDMR
TPPDFAAGPLARSALLRVGAARFFWYVCAHHIVTDAYGTALVVQRTAQLYGARVRGAAPP
PAWFGTLDALIDEDRAYRESAAFADDRDYWRARLAAAPEPRSLSPVALPGQFAPAGDFHR
QWGELDAATSDGLRAMARAGAQGMPPLVAAMMAAYVHRFTHERDVVLGLPVMARLSRATR
RTPGMVANVLPLRFAFDRGTTFAALHAQCAAEMRASLRHQRYRGEALLRDAQQSRPAERL
HAQNVNVMAFERALAFGDCPARSHSLSNGPVDDFSITVYDDGARQPIRIAFDANAAHYAS
GDLAAHRERFLRLGVALANAAQRPIADAQWLTPAERRTLVGERGTPAPDAGVPFDTIAAR
FAARAAERPDAITLVDRGRRITYGELNARANRLAHVLIEAGVGPEALVGLHMPRSAELVV
GMLAILKAGGAYVPLDPAYPASRIEFMVADARPMLSITTGEHAAQLPARTPTIVLDAADA
QAALRRAPAHDPVRPAPLDREHAAYVIYTSGSTGKPKGAVVSHRNVIRLLDGTRGWFDFG
AAHTWTLFHSFAFDFSVWECWGALLTGGRLVVVPYDVSRSPAEFLKLLVDERVTVLNQTP
SAFRQLMQADEAHADLSARLALRYVVFGGEALDARSLARWYERHADTAPRLVNMYGITET
TVHVSYLALSRAIAGMPANSLIGRPLPDLRVYVLDAALRPVPAGVPGEMYVAGAGLARGY
LRRPSLTAQRFIADPFGPPGTRMYRTGDVARWRADGGLDFIGRADEQVKVRGFRVELGEI
AARLACDPSVAQAQAVVRQDGPAHERLVAYVVPRAGATIDVCALRASLAAEMPEYMVPAA
IVALDAMPLTPNGKLDRAALPAPIVTGTSRRAPENRIEQQVCAMFAELLDAQTLGAEDNF
FELGGDSLLAMRAINKLRQTFDVELTIRDLFSAPTVAALSMRLDAQLAARRAHADGAELP
AG
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatatcgacacaggacttcgcctcgccatgaacatgcgcgatacatcgcttcgc
ccgctgctgcccgcccagcgggagatctggctcgccgagcagttgcgcccgggcacgggt
gtctacaacacggcgggctacgccgacatcgtcggcgccgtcgatcacggcgcgctgcgg
gacgcgttcggccacgcgatgcgcgaggccgacgccgtgcgcgcgacgttctccgcgcac
ggcgacgacgcgtggcagacgccgcgcgatgcgccgcacgccgacgtgccgctcgtcgac
gtgagcggccaggccgatcccgccggcgtcgcgctcgcatggatgatgcgcgacatgcgc
acgccgcccgatttcgcggcgggcccgctcgcgcgcagcgcgctcttgcgggtgggggcg
gcgcgctttttctggtacgtctgcgcgcatcacatcgtcaccgacgcgtacggcacggcg
ctcgtcgtgcaacgcacggcgcagctctacggcgcgcgggtgcgcggcgcggcgccgccg
cccgcgtggttcggcacgctggacgcgctcatcgacgaggaccgcgcgtatcgtgaatcg
gccgcgttcgccgacgatcgcgattactggcgcgcccgcctggcggcggcgccggagccg
cgcagcctgtcgcccgtcgcgctgccggggcagttcgcgccggccggcgactttcaccgg
caatggggcgagctcgacgccgcgacgagcgacgggctgcgcgcgatggcgcgcgccggc
gcacaaggcatgccgccgctcgtcgcggcgatgatggccgcctatgtgcaccggttcacg
cacgagcgcgacgtcgtgctcggcttgcccgtcatggcgcggctaagccgcgccacgcgc
aggacgccgggcatggtcgcgaacgtgctgccgctgcgcttcgcgttcgatcgcgggacg
acgttcgcggcgctccacgcgcaatgcgcggccgagatgcgcgcgtcgctgcggcaccag
cgctatcgcggcgaggctctgctgcgcgatgcgcagcagagccggccggccgagcgcctt
cacgcgcagaacgtgaacgtgatggcgttcgagcgggcgctcgcgttcggcgattgcccg
gcgcgctcgcacagcctgtcgaacggccccgtcgacgatttttcgatcaccgtctacgac
gacggcgcgaggcaaccgatccgcatcgcgttcgacgcgaacgcggcgcactatgcaagc
ggcgatctggccgcgcatcgcgagcgctttctgcgccttggcgtcgcgctcgcgaacgcg
gcgcagcggccgatcgccgacgcgcagtggctcacgcccgccgagcgccggacgctggtc
ggcgaacgcggcacgcccgcgccggatgcgggcgtgcccttcgacaccatcgccgcgcgc
ttcgcggcgcgggccgccgagcgcccggacgcgatcacgctcgtcgatcgcgggcggcga
atcacgtacggcgagctgaacgcgcgcgcgaatcggctcgcgcacgtgctgatcgaggcg
ggcgtcgggccggaggcgctggtcggcctgcacatgccgcgctcggccgagctcgtcgtc
ggcatgctcgcgatattgaaggcgggcggcgcgtacgtgccgctcgaccccgcctatccg
gcctcgcgcatcgaattcatggtggccgacgcgcggccgatgctgtcgatcacgacgggc
gagcacgcggcgcaactgccggcccgcacgccgacgatcgtgctcgacgccgccgacgcg
caggcggcgttgcggcgcgcgcccgcgcacgacccggtgcggccggcgccgctcgatcgc
gagcacgcggcgtacgtgatctacacgtccggctccaccggcaagccgaagggcgcggtg
gtgtcgcatcgcaacgtgatccgcctgctggacggcacgcgcggctggttcgatttcggc
gcggcgcatacgtggacgctgttccattcgttcgcattcgatttctcggtgtgggagtgc
tggggcgcgctgctcacgggcgggcggctcgtcgtcgtgccttacgacgtgagccgctcg
cccgccgagttcctgaagctgctggtcgacgagcgcgtgacggtgctcaatcagacgccg
tcggcgtttcgccagctgatgcaggccgacgaggcgcacgcggacttgagcgcgcggctc
gcgctgcgctacgtggtgttcggcggcgaggcgctcgacgcgcgcagcctcgcgcgctgg
tatgagcggcacgcggacaccgcgccccggctcgtcaacatgtacggcatcaccgagacg
acggtccacgtcagctatctggcgctcagccgcgcgatcgccgggatgccggcgaacagc
ctgatcggccggccgcttcccgacttgcgcgtgtatgtgctcgacgccgcgctgcgcccc
gtgccggcgggcgtgccgggcgagatgtacgtcgccggcgcggggctcgcgcgcggctat
ctgcgccggccgtcgctcaccgcgcagcgcttcatcgccgatccgttcgggccgccgggc
acgcgcatgtaccgcacgggcgacgtcgcgcgatggcgggccgacggcgggctcgatttc
atcgggcgggccgacgagcaggtgaaagtgcgcggctttcgcgtggagctcggcgaaatc
gccgcgcggctcgcgtgcgatccgtcggtcgcgcaggcgcaggccgtcgtgcggcaggac
gggcctgcgcacgagcggctcgtcgcgtacgtcgtgccgcgcgccggcgcgacgatcgac
gtttgcgcgctgcgcgcgtcgctcgcggccgagatgccggaatacatggtgcccgcggcc
atcgtcgcgctcgatgcgatgccgctcacgccgaacggcaaactcgaccgcgcggcgctg
ccggcgccgatcgtgacgggcacgagccggcgcgcgccggaaaaccgcatcgagcagcag
gtgtgcgcgatgttcgcggaactgctcgatgcgcagacgctcggcgccgaggacaatttt
ttcgagctcggcggcgattcgctgctggcgatgcgcgcgatcaacaagctgcggcagacg
ttcgatgtcgagctgacgattcgcgatctgttttccgcgccgactgtcgcggcgctcagc
atgcggctcgatgcgcaattggcggcgcgccgcgctcacgcggacggcgctgagctgccc
gccgggtag

DBGET integrated database retrieval system