KEGG   Burkholderia mallei NCTC 10229: BMA10229_1831Help
Entry
BMA10229_1831     CDS       T00471                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00020  Citrate cycle (TCA cycle)
bml00190  Oxidative phosphorylation
bml00650  Butanoate metabolism
bml01100  Metabolic pathways
bml01110  Biosynthesis of secondary metabolites
bml01120  Microbial metabolism in diverse environments
bml01130  Biosynthesis of antibiotics
bml01200  Carbon metabolism
Module
bml_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bml_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bml_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMA10229_1831 (sdhB)
   00650 Butanoate metabolism
    BMA10229_1831 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BMA10229_1831 (sdhB)
Enzymes [BR:bml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BMA10229_1831 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BMA10229_1831 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_18 Fer4_4 Fer4
Motif
Other DBs
NCBI-ProteinID: ABM98704
UniProt: A2S109
LinkDB All DBs
Position
II:1880545..1881246
Genome map
AA seq 233 aa AA seqDB search
MAKRIFEIYRYDPDKDAAPRMQTYELEIQHERMLLDALVKLKSVDETLSFRRSCREGVCG
SDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLICDFTQFFNQYHSIRPYLIND
EPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDRATGERLDNLDDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRAV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacgcattttcgaaatctaccgctacgatccggacaaggacgccgcgccgcgc
atgcagacgtacgagctggagatccagcacgagcggatgctgctcgatgcgctcgtcaag
ctgaagtcggtcgacgagacgctgtcgttccgccgctcgtgccgcgaaggcgtgtgcggc
tcggacgcgatgaacatcaacggcaagaacggcctcgcgtgcctgacgaacctgaacgac
ctgccgcagaagatcgtgctgcgtccgctgccgggcctgcctgtcgtgcgcgatctgatc
tgcgacttcacgcagttcttcaaccagtaccactcgatccgcccgtacctgatcaacgac
gagccgccgcccgagaaggagcgtctgcaatcgccggaagagcgcgacgagctcgacggc
ctgtacgagtgcattctgtgcgcgagctgctcgacgtcgtgcccgagcttctggtggaat
ccggacaagttcgtcggcccggcgggcctgctgcaggcgtatcgcttcatcgcggacagc
cgcgatcgcgcgacgggcgagcgcctcgacaacctcgacgatccgtatcgcctgttccgc
tgccacacgatcatgaactgcgtcgacgtgtgcccgaagggcctgaacccgacgaaggcg
atcggcaagatcaaggaattgatggttcgtcgcgcggtctga

DBGET integrated database retrieval system