KEGG   Burkholderia mallei NCTC 10229: BMA10229_1882Help
Entry
BMA10229_1882     CDS       T00471                                 

Definition
(GenBank) putative ribonuclease BN
  KO
K07058  membrane protein
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BMA10229_1882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ABM99270
UniProt: A2S160
LinkDB All DBs
Position
II:complement(1932678..1933601)
Genome map
AA seq 307 aa AA seqDB search
MKSLIPQQPQKLVRHNVNWALDAFKRFSADRCTAMAASIAFYSAFSLAPTLVMVIAVAGW
FFGADAARGEVFSHVHELIGNEAAAGVQTIVENAHRSGSRGGTAALISFAMLALGASATF
ASLNTALSVIWPATGARASSVLGLVRIRLISFGLVLGVAFLLIVSLVLDTAITFIGRWLW
GASPYVVIGNLLQFSIGIAVLAFAFGTLMKFLPDARVSNRDAMTGGIVSAVLFSAGKKLF
ALYLAHAGTASAFGAAGSFAVLLMWLYFSAAVLLLGAEFAAARGAARASGEAAQPGEAAP
ARGGPRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccttgatcccgcaacaaccgcaaaagctcgtgcgtcacaacgtcaactgggcg
ctcgacgcgttcaagcgcttctccgccgaccgctgcacggcgatggcggcgagcatcgcg
ttctattcggcgttctcgctcgcgccgacgctcgtgatggtgatcgcggtcgccggctgg
ttcttcggcgccgacgccgcacgcggcgaggtgttcagccacgtgcacgagctgatcggc
aacgaggcggcggccggcgtgcagacgatcgtcgagaacgcgcatcgcagcggcagccgc
ggcggcaccgcggccctgatctcgttcgcgatgctcgcgctcggcgcatccgcgacgttc
gcatcgctgaacaccgcgctcagcgtgatctggcccgcgaccggggcgcgcgcgtcgtcg
gtgctcggtctcgtgcggatacggctgatctcgttcgggctcgtgctcggcgtcgcgttc
ctgctgatcgtgtcgctcgtgctcgacaccgcgatcaccttcatcggccgctggctgtgg
ggcgcgtcgccgtatgtcgtgatcggcaacctgctgcagttctcgatcggcatcgcggtg
ctcgcattcgcgttcggcacgctgatgaaattcctgccggacgcgcgtgtctcgaaccgc
gatgcgatgacaggcggcatcgtctccgccgtgctgttctcggcgggcaagaagctgttc
gcgctgtatctcgcgcacgccggcaccgcgagcgcgttcggcgccgcgggatcgttcgcc
gtgctgctgatgtggctgtacttctcggccgcggtgctgctgctcggcgcggaattcgcg
gcggcgcgcggcgcggcgcgcgcgtcgggcgaagccgcgcagcccggcgaggccgcgccc
gcgcgcggcggcccgcgcgactga

DBGET integrated database retrieval system