KEGG   Burkholderia mallei NCTC 10229: BMA10229_1937Help
Entry
BMA10229_1937     CDS       T00471                                 

Definition
(GenBank) putative peptide synthetase
Organism
bml  Burkholderia mallei NCTC 10229
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABN00157
UniProt: A2S1B5
LinkDB All DBs
Position
II:1989456..1994018
Genome map
AA seq 1520 aa AA seqDB search
MRARAFHSVISPYHIRLPLRRIRIIREYVNTTQEYGVMTDMLDSSEISVRDDIDPVPGAA
PERVLALTAGQYGIWLDQMLNPDLPCYILGAILRIDGTFDEALLTSVVNEVVNANDSLRA
VLVSEGGSVRQRVLSDVELEIAHIDFSGSAHPHDSAWRYMRTAFDTAFALDGLLCDFRIV
RESPSRTYWMYRCHHLVADGQSVSMICRMIVDLYNRRASADMARIEPTPSYFDSLDDDRK
YAESSRYERDAQFWQDKFSSLPPPLLSSRSSEAAARPASFPDGQVNLTIERAKYDRLGRI
AEASGCTIVHVMFGVLALYFSRAFQVDEVVIGMPVHNRSTAQQKRAIGMFASVVPIRIPV
DGNERFVSLLNGVSAELRHCYRHQRFPIAELNRRLGLVRTGRRQLFDLTLSFEKFPLDFY
IGDVKLGLTSMRHRFEQTPITVNVQDYHEDQDLVMQFNYDVNAFSHAEVDNIGTRIGGLL
DALIEHHDDMPVGMLPLLDEAERKQVVYEWNATERDYPIEQCIHQLFEAQVDRKPEAIAL
TFDGRRLSYAELNARANRLAHYLQGRGVGPDRLVALCAERGIEMVVGLLAILKAGGAYVP
LDPSHPPERLRRMLDDTNPVAVLVDDIGADALASFESHVAARSPRVHLSRDIAQWRACSP
ANPPTPRERAARRLAYVIYTSGSSGEPKGVMNEHRGVVNRLWWMQQTYALDERDAVLQKT
PFSFDVSVWEFFWPLMSGARLVIAKPEGHKDPAYLSELIDRERVTTLHFVPSMLQAFLED
EGAARGCGSVKRVMCSGEALPPSLVKRFYRCLPDARLHNLYGPTEAAVDVTAWACDAEEG
GASVPIGRPIANTRIYVLDEYGQPVPRGVAGELYIGGVQVARGYLNRPELTRERFVDDPF
VAGGRLYKTGDLARWRTDGSLEYLGRNDFQVKIRGFRIELGEIEAQLAKVAGVRETVVLA
RDSGSPVGEKRLVAYYTGNADVAALREQATRHLPAYMVPSAYVRLDAWPLTPNGKLDRRA
LPAPADDAYARAEYEAPQGAKEEALAAIWKDLLPVERISRHDNFFELGGHSLLVIGLSEK
LRAAGLHADVRVVYRASTLADLAAHLGTDNQDIRIPPNLIADGDEHITPAQLTLVALSQE
SIDALVAKVEGGAANVQDIYPLAPLQEGILFHHLMSGESDPYVLSGVLAFRSREVMERFV
SALQQVIDRHDILRTGFFWEGLEQPVQVVQRRATLPVSVVELDAREGDIVRQLETRFDSR
GYRMDVSRAPLMHVHAACDGEHERWVARVLFHHLSIDHTTLERVIEEARAIGQGRAEDLP
QPVPFRNFVAQARLGVSEADHEAYFRAKLGDIDEPTAPFGLLSVQGDGREIAEAARTLKP
ELSGALRGHARRLGVSAASMMHVAWGLVLSRTTGRQDVVFGTVLFGRMQGGAQSDRALGL
FINTLPVRMRVAQTGVEASVKGAHAQLAELMRHEHAPLVLAQRCSGVPAQTPLFTSLLNY
RYSKPKVAAAHIADGIELLD
NT seq 4563 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgcgggcgtttcattcggtgatatcgccgtatcacattcgccttccgttgcgg
cgcattcgaatcattcgtgaatacgtgaacacgactcaggagtatggcgtcatgactgac
atgctcgattcttcggaaatttcggtccgcgacgatatcgatcccgttccgggcgccgcg
cccgaacgcgtccttgcgctgacggccggccagtacggcatctggctcgatcaaatgctc
aatccggatctgccgtgttacatcctcggcgcgattcttcgaatcgacggtacgttcgac
gaggcgttgctgacgtcggtcgtcaacgaagtcgtcaatgcgaacgattccctgcgcgcg
gtgctggtgagcgaaggcggttcggtgcggcagcgtgtcctgtccgacgtggagctggag
attgcgcatatcgatttttccggctccgcgcacccgcacgacagcgcgtggcgatacatg
cgaacggcgttcgatacggcgttcgcgctcgacggactgctgtgcgatttccgcatcgta
cgcgagagcccgtctcgcacgtactggatgtatcgctgccatcatctggttgcggacggt
cagagcgtgtcgatgatctgccggatgatcgtcgatctctataaccgccgtgcgagcgcg
gacatggcgcgcatcgagcctacgccctcctatttcgattcgctcgacgacgaccgcaag
tatgccgagtcgtcccgttacgagcgcgacgcgcagttctggcaggacaaattttcgtcg
cttccgccgccgttgctttcgtcgcgctcgagcgaggcggccgcacgccccgcgtcgttt
cccgacggccaggtgaatctgacgatcgagcgcgcgaagtacgatcggctcgggcggatc
gccgaggcgagcggatgtacgatcgtccacgtgatgttcggcgtgctcgcgctctacttc
tcgcgagcgtttcaggtcgacgaggtggtgatcggcatgccggtgcacaaccgaagcacc
gcacagcagaagcgcgcgatcggcatgttcgcttcggtggtgccgattcgcatcccggtc
gacgggaacgagcgtttcgtatcattgctgaacggcgtgtcggccgagttgcggcattgc
tatcgccatcagcgttttccgatcgcggagttgaaccggcgtctggggctcgtgcgaacc
ggtcgcaggcagcttttcgatctcacgctgtcgttcgagaagttcccgctcgatttctac
atcggcgacgtcaagctagggctgacatcgatgcggcaccgtttcgagcagacgccgatc
acggtcaacgtccaggattatcacgaggaccaagacctcgtcatgcagttcaattacgac
gtcaatgcgttctctcatgcggaggtcgacaacattggcacgcgcatcggcgggttgctc
gatgcattgatcgagcatcacgacgatatgccggtgggcatgctgccgttgctagacgaa
gccgaacgcaagcaggtggtgtacgagtggaacgcaacggagcgtgactatccgatcgag
caatgcattcatcagttgttcgaagcgcaggtggatcggaagccggaggcgattgcgctg
acgttcgacgggcggcgactgagctacgcggaactcaacgcccgagcgaaccggcttgcg
cactatctgcaggggcgcggcgtgggcccggaccgactggttgcgctttgcgccgaacgc
ggaatcgagatggtggtggggctgctggcgatcctgaaggcgggcggcgcgtatgtgccg
ctggatccgagccatccgcccgagcgtttgcgccggatgctggacgatacgaacccggtg
gcggtgctcgtcgacgacatcggcgcggacgcgctcgcatcgttcgaatcacatgtcgcg
gcccgttcgccccgtgtgcacctgtcgcgcgacatcgcgcaatggcgggcatgcagccca
gcgaatccgcctaccccgcgggagcgcgccgcgcggcgtctcgcatacgtgatctacacg
tcgggctcgagcggcgagccgaagggagtgatgaacgagcatcgcggggtggtgaaccgg
ctgtggtggatgcaacagacgtacgcgctggacgagcgcgacgcggtattgcaaaagacg
ccgttcagcttcgacgtatcggtgtgggagttcttctggccgctgatgtcgggcgcgcgg
ctggtgatcgcgaagccggaggggcacaaggatccggcgtacctgtcggagttgatcgat
cgcgaacgcgtgacgacgctgcacttcgtaccgtcgatgctgcaggcgttcctggaggat
gagggcgcggctcggggctgcgggagcgtgaagcgggtgatgtgcagcggagaggcgctg
ccgccgtcgctggtgaagcgcttctatcgttgcttgccggatgcgcgcttgcacaatctg
tacggtccgacggaagcggcggtggacgtgacggcgtgggcgtgcgatgcggaagaaggg
ggcgcgtcggtgccgatcggtcggccgatcgcgaacacgcggatctacgtattggacgag
tatggccagccggtgccgcgaggggtggcgggggaactgtatatcggcggcgtgcaggtg
gcgcgagggtatctgaaccggccggagctgacgcgggagcggttcgtcgacgatccgttc
gtggcgggcggtcgactctataagacgggagatttggcgcgttggcgcacggacgggagt
ctggagtatctgggtcgaaacgatttccaggtgaagatacgcggtttccggatcgagttg
ggggagatcgaggcgcaactggcgaaggtggcgggcgtgcgcgagacggtggtgttggcg
cgcgactcgggttcgcctgtcggcgagaaacgcctcgtcgcgtactacacggggaatgcc
gatgttgcggcgttgagggaacaggcaacacgacatctgccggcctacatggtgccatcg
gcgtacgtgcggctggacgcgtggccgctgacgccgaacggcaagctggaccggcgcgca
ctgcccgcgccggcggacgacgcgtacgcccgcgccgaatacgaagcgccgcagggcgca
aaggaagaagcactggccgcgatctggaaggacctgctgcccgtggagcgcatcagccgc
catgacaatttcttcgaactcggcgggcattcactgctcgtgatcggcttgagcgagaag
cttcgggcggcgggcttgcatgccgacgtgcgtgtcgtctaccgggcgtcgacgctggcc
gatctcgccgcgcatctggggaccgacaatcaggacatccggataccgccgaatctgatt
gccgacggcgacgagcacattacgccggcccaactgacgctggtggcgctgagccaggag
tcgatcgacgcgttggtggcgaaggtggaaggcggtgcggcgaacgtgcaggacatctat
ccgttggcgccgttgcaggaaggcattctgtttcatcacctgatgtcgggggaaagcgat
ccgtacgtgctgtcgggcgtgctggcgttccgcagccgcgaggtgatggagcggtttgtg
tcggcattgcagcaggtgatcgatcggcacgacatcctgcgcaccggcttcttctgggag
ggactcgagcaaccggtgcaggtcgtgcagcgccgggcgacgttgccggttagcgtcgtc
gagctcgatgcacgcgaaggcgacatcgtgcggcaactggagacccgcttcgattcgcgc
ggctatcggatggacgtgagccgcgcgccgttgatgcacgttcacgcggcttgcgacggc
gagcacgaacgctgggtggcgcgcgtgctgtttcaccatctgtcgatcgatcatacgacg
ctcgagcgtgtgatcgaggaggcgcgcgcgatcgggcagggccgagcggaggacttgccg
cagccggtgccgttccggaatttcgtcgcgcaggcgaggctgggggtgagcgaggcggac
cacgaggcgtacttcagggcgaagctgggggacatcgatgagccgacggcgccgttcggt
ctgctgagcgttcagggagacgggcgtgagatagcggaggcggcgcggacgttgaagccg
gagctgtcgggggcgcttcgcggacatgcgcgccggctgggggtgagcgcggcgagcatg
atgcatgtggcgtgggggctggtgctgtcgcgcacgacggggcggcaggacgtggtgttc
ggcacggtgctgttcgggcggatgcagggaggcgcgcaatcggatcgagcgctgggcttg
ttcatcaacacgttgccggtgcggatgagggtagcgcagacgggcgtggaggcgagcgtg
aagggggcgcatgcgcagctggcggaattgatgcgtcacgagcatgcgccgctggtgctg
gcgcagcgttgcagcggggtgccggcgcagacgccgttgttcacgtcgctgctgaactat
cggtacagcaagccgaaggtcgcggccgcgcatattgccgacggcatcgaattgctcgac
tga

DBGET integrated database retrieval system