KEGG   Burkholderia mallei NCTC 10229: BMA10229_2155Help
Entry
BMA10229_2155     CDS       T00471                                 

Definition
(GenBank) putative long-chain-fatty-acid--CoA ligase
Organism
bml  Burkholderia mallei NCTC 10229
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C PP-binding
Motif
Other DBs
NCBI-ProteinID: ABM99042
UniProt: A2S1X9
LinkDB All DBs
Position
II:complement(2203847..2205706)
Genome map
AA seq 619 aa AA seqDB search
MSSLSQQLSALGSRIFTSAPFGPGVSMQNLAEWSSLAHVQLLGRVAAEFGVDIDIEEAYR
LDSFERLLHYIERQRGPGDEAPPASAASATAAGDAGEAPATIGALLRARAAALPDEPFLF
FPADDRSYTYRAFHGLACAAAETLRAHGLARGDRLCVVLPNGPEFLAYYFGAHLLGVVSV
PINPALTAAECAYIVRNSGAKLVVFDRRMTNLREAVRTELADDRGARLASADAASGFGLE
ALAAAADHATLAPEPGLAADDDASILYTSGTTGHPKGVVLSHRNLLSDARALVDWFAFEP
GTRTMCILPLFHNNGQVITLLSPLIAGGSSVILEGKSALPSFWKLIDTYRVNWTSVMPAF
LSAFLEYGLKRTDDTLRGIVCGGQVLLDEVRSRFETEYRVPVFEGFGLTETTSFATMNRH
PAERRRFGSIGVALPCNALRIVDANGREAAANETGEILIRGENVAARYHGRAELTAERFR
NGWLHTGDYGYRDDDGHFFFATRVDDLIIKGGENIYPAEIENVLHGCGDVVECAALGVPD
PILGQEVCVYVKLRPASTLGKDDIRRLCEGRIAHYKCPRHVVLLNELDDLPELPKGPTRK
ILRRKLLAHFTTLRERAAA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctcgctttcacagcaattgagcgctctcggcagccggatcttcacgagcgcgccg
ttcggccccggcgtatcgatgcagaatctcgccgaatggtcgtcgctcgcgcacgtccag
ttgctcggccgggtcgccgccgagttcggcgtcgacatcgacatcgaagaagcctatcgg
ctcgacagcttcgagcggctgctgcattacatcgagcggcagcgcgggccgggcgatgag
gcgccgcccgcgtccgccgcctcggcgacggcggccggcgacgccggcgaagcgcccgcc
acgatcggcgcgctgcttcgcgcgcgcgccgccgcgctgcccgacgagccgttcctgttc
ttcccggccgacgatcgcagctacacctaccgcgcgttccacgggctcgcgtgcgcggcg
gccgaaacgctgcgcgcgcacgggctcgcgcgcggcgatcgcctgtgcgtcgtgctgccg
aacggcccggaattcctcgcgtactacttcggcgcgcatctgctcggcgtcgtgtcggtg
ccgatcaacccggcgctcaccgccgccgagtgcgcgtacatcgtccgcaacagcggcgcg
aagctcgtcgtgttcgaccggcgcatgacgaacctgcgcgaggccgtgcgcaccgaactc
gccgacgatcgcggcgcgcgcctcgccagcgccgacgccgcatccggcttcggcctggaa
gcgctcgcggcggcggccgatcacgcgacgctcgcccccgagcccggtctcgccgccgac
gacgacgcgagcattctctacacgtccggcacgacggggcacccgaagggcgtcgtgctg
tcgcaccgcaatctcctgtccgatgcgcgcgcgctcgtcgactggttcgcgttcgagccc
ggcacgcgaacgatgtgcatcctgccgctgtttcacaacaacggccaggtgatcacgctg
ctgtcgccgctgatcgcgggcggcagctcggtgatcctcgaaggcaaatcggcgctgccg
tcgttctggaaactgatcgacacgtatcgcgtgaactggacgagcgtgatgcccgcgttc
ctgtccgcgttcctcgaatacgggctcaagcgcaccgacgatacgctgcgcggcatcgtc
tgcggcggccaggtgctgctcgacgaagtgcgcagccgcttcgagaccgaataccgcgtg
ccggtattcgaaggcttcgggctcaccgagacgacctcgttcgcgacgatgaaccgccac
cccgccgagcgccgccgcttcggctcgatcggcgtcgcgctgccgtgcaacgcgttgcgc
atcgtcgatgcgaacggccgcgaggcggccgcgaacgagacgggcgagatcctgatccgc
ggcgagaacgtcgcggcgcgctaccacgggcgcgccgagctcaccgccgagcgctttcgc
aacggctggctgcataccggcgattacggctatcgcgacgacgacggccatttcttcttc
gcgacccgcgtcgacgatctcatcatcaagggcggcgagaacatctatccggccgagatc
gagaacgtgctgcacggctgcggcgacgtcgtcgaatgcgcggcgctcggcgtgcccgat
ccgattctcggccaggaggtgtgcgtgtacgtgaagctgcggccggcgtcgacgctcggc
aaggacgacatccgccgcctgtgcgaaggccgcatcgcgcattacaagtgcccgcgccac
gtcgtgctgctcaacgagctcgacgatctgccggaactgccgaagggcccgacgcgcaag
atcctgcgccgcaagctgctcgcgcatttcacgacgctgcgcgagcgggcggccgcatga

DBGET integrated database retrieval system