KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0288Help
Entry
BMA10229_A0288    CDS       T00471                                 

Definition
(GenBank) putative non-ribosomal peptide synthetase
Organism
bml  Burkholderia mallei NCTC 10229
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABN02075
UniProt: A2S2X1
LinkDB All DBs
Position
I:complement(309285..319169)
Genome map
AA seq 3294 aa AA seqDB search
MTSFPTALHHRIHALARLDPDAPALASFAPDTVRLTRGELDERAARLAAQLRAAGVGAEV
PVGVCVARSCDLFVALLAVMKAGGAFVALDPRHPAARLDWVARDAGLAHGIVDASADAAM
RARFARCFDVGGVAAADPAAPREHGGDVHPRAAAYMIYTSGSTGTPKAVVVEHGPLAAHG
DALAESLPIGPDDRVLHFASVNFDVAIEAWLVPLAVGGSVVISDPPPFTPDAAHALISRE
RVTNTTLPPAYLREFAAVCAREGVPPSLRVLLFGGEAMSQDAFDEIRRVFPAIRLVNGYG
PTETVISPMLWPVAPGTTPALDAGNGYASLPIGWPIGRRVARVERADGTVARGEAGELLL
GGACLARGYHGRAALTAERFLPDPAGEPGARIYRTGDLARERADGAFDYLGRIDDQVQVR
GVRVEPAEIAACLLTHPGVRDAGVLAETAGGRTQLIACVALAAPPRETPSGGDAPPDDDA
LRAHVAAHLPAAWLPHRFVRFDKLPYTLNGKLDRVALRDAVAARPAEAAADVDAPRTDTE
RRVAALWQRLLNDPAPIGRVDRFFARGGDSLAAMQLQTAIRLDWRVNLRLDTLFDDAPLA
ELAARIDAAEREARQPAAIGTTARRAIAADAIDARATGDARATGQMGRTGAAGEATEAAG
ALERPASFAQQRFWVLARTQDAGAAYHVSFHWDIDGALDLGTLQRALDMLIARHEAWRTT
LVENDDGVVLQRIHAALPVRIAAVDLRGEAGASRAARLAELTERHAGAPFDLSDGPLVRA
LLVTLADGAQRFLLTTHHAVSDGWSSRCAFAELTAAYAALAEGRAPELPALPIQYADYAQ
WQRDALDAHETARELAYWRGALDGAPAPLALPLDRPRAAERDYRGGRLARRLSPAASDAV
RAAARRLHASPFTVLLAAFDAWLFRLTGERDLVVAAPIAQRARPETAPLVGLFLNTLALR
ARVSPAQSFESLVASVRDAAFGAFAHQDVPFDKVIDAVKPPVRRGDEWLRVKFAQQFDLE
CRASLPGAAVRMAPGLDTAARFDYALDFTDDPRGIEFVAAYARDGIDEATAHAWLDSFAA
LVEDAVREPRRPIAALAVAQAGAPCALIAGRPLATAPDVLALFAREAAEHPHRVALADAD
TRLTFAELDDASNRVALALRRDAARDEAPGAETPVAICIERSARFVVAFLGVLKSGAYAV
PLDPASPRERIAAALAACGACRMLAAGALDALGEFDGVAVQDIDACGHDASLANAAAPRV
PPQPEQAAYLIFTSGSTGAPKGVVVPHRALADYVAGMLDELAFAPHASMAMVSTVAADLG
HTTLFGALCSGRTLHLLPAQAAFDPDRFAHEMATRKVGVLKIVPSHLHALLDAQRAADVL
PAHALVTGGEALPWALVERIAALKPDCRVINHYGPTEASVGALVCDTSAPAQADLRAAAA
SSPGEAARGVPLGRPLPNAHACVLDAYGSSVPVGAIGELYLGGPGLARGYLGRAAASAER
FVPHPHVAGARVYRTGDRVRLRADGRLDFLGRLDDQVKIRGYRVEPGEVSAALRALPGVA
QAETLALEHEGRLRLAAFATPEAGARIAADALRDALAARLPDYMVPAALVVLDALPVTAN
GKIDRAALRARAAAPAPATAGDEDAPQGPIEATLAEVWRDVLKAARVGRHDNFFELGGDS
ILVLQVIARARKRGVKFTPKQLFDGPTLAELARVAVAIEAAAPASGAAHGAAIGANAAAA
RRDEAVLTPAQLRFFALDIPRRGHWNQSIALDVAGAFDFDAFARAFDALLTHHPVFRERF
APTGDGGGWQRSAAPRAFDTLPLAAAAARDEADALAQFDALQATLDLTHGPLACAFAAVL
PSGATKLYLAIHHAIVDGVSWRVLLDDLDAAYRAACERRAVRLGPTGASASEWAARLARA
ARDPAGPFAGELPYWAALAAPHDDLRPDRPDAAATNAHADVVIQTLDAALTREVLTDANA
AYRTQAVELLIAALVAALGQHTGAAACRLELEGHGREALFDELDASRTLGWLTSHYPVAF
AVEATPAATLAGVKDALRAVPNKGLGFGVLRHYGDDATRAALARVARPRVTFNYLGQFDA
PRDAALVPRFGGAGRERDPAGPLGNALAIHAYVDANGERALKVHWVYGATQFDRATIDAL
AARFDAALRALAAACRARVAERGAGATPGDYPLARAGGLTQAALDRLPFDARAIDDIYPL
SPMQQGILFHSLFAPERATYVNQLVATLVDPDVERLRAAFDAAVPRHDILRTGFAAHEAA
PMQIVHRHARMPVEIVDWRGAHASPAALDTALDAWLAADRARGFDLAAPPLMRVTLIRTD
DADWRLVWTRHHLLLDGWSTARLFADVLSDYIEPPRANPFAAPARTRYRDFIAWLARRDA
QADRAFWLGRLARLDEPTHVAERARGASAAAHEAAGRANWRATLPAADTARIGEAARRMK
VTVNTIVQGAWALALQRITHRRAVAFGATVAGRPHALPDVDTVLGLFINTLPVITAPLPQ
LAARDWLASLQRDNAAALEHAHTPLYEIQQWAGLGGALFDTLVVFENYPVDEAWQGRDAR
ALQKRDLRNIEATDFAVTLVIEAGDTLAIDYGYDPARIGPARVEALHRAFAACIAGLVDH
PDAPLGTISCASADDLALIARANATELDWPAAQRAPLFAQFEAAARARPDAIALECLASS
DGGDGARAQMRYGELDAKADRVAAALAASGVRPDSVVALCVERSFDMVVALVGTMKARAA
YLPVDPDYPAERIAYLLGDAKPPVVITQAHLRARVDAALAGADAAVVTVDELLARAAGAE
PEAERVAAAADVAPGQLAYLIYTSGSTGQPKGAGNTHGALANRIAWMQRAYRLAPDDVVL
HKTPFGFDVSVWEFVWPLAVGAKLAIAAPGDHRDPARLVAAIDAHRVTTLHFVPSMLAAF
VAYLDDFGAAARCASVRTIVASGEALAPELVARVAALLPHAQLHNLYGPTEAAIDVSHWR
CTADDAAADAVPIGHPIANLRLHVLDAALHPAPVGATGELYLGGAGLARGYLGRAALTAE
RFVPDPFVPGARLYRTGDLARRRADGALDYLGRLDTQVKLRGQRIELGEIEALLRATDGV
RDAVVIVRDERLVGYVACATPAGFDAAAQIERLRARLPAYMVPAQLVALDALPVTPNGKC
DRRALPAPVFDARVVDAPRTATERALAAIWQRVLTLPELGRDDDFFALGGHSLLAAQANA
QANLQWSLTLPLRTIFDERTLARCAAAIDRARDAGRERDAAGAIDALLGELEAQ
NT seq 9885 nt NT seq  +upstreamnt  +downstreamnt
atgacgagctttccgactgcgctgcatcatcgaatccacgcgcttgcgcgactcgacccc
gacgcgcccgcgctcgcgtcgttcgcgcccgacaccgtgcgtctcacgcgcggcgaactc
gacgagcgcgccgcgcgcctcgccgcgcaactgcgcgcggcgggcgtgggcgcggaggtg
ccggtcggcgtgtgcgtcgcgcgctcgtgcgacctgttcgtcgcgctgctcgcggtgatg
aaggcgggcggcgcgttcgtcgcgctcgatccgcgccatccggccgcgcggctcgactgg
gtcgcgcgcgacgcggggctcgcgcacggcatcgtcgacgcatcggccgacgccgcgatg
cgcgcgcgcttcgcgcggtgcttcgacgtcggcggcgtcgccgcggcggacccggccgcg
ccgcgcgagcacggcggcgacgtgcatccgcgcgcggccgcgtacatgatctatacgtcc
ggctcgacgggcacgccgaaggcggtcgtcgtcgagcacggcccgctcgccgcgcatggc
gacgcgctcgccgaatcgctgccgatcgggcccgacgatcgcgtgctgcatttcgcgtcg
gtgaacttcgacgtcgcgatcgaggcgtggctcgtgccgctcgcggtcggcggcagcgtc
gtcatcagcgatccgccgccgttcacgcccgacgccgcgcacgcgctgatctcgcgcgag
cgcgtgacgaacacgacgctgccgcccgcgtacctgcgcgagttcgcggccgtgtgcgcg
cgcgaaggcgtgccgccgtcgctgcgcgtgctgctgttcggcggcgaggcgatgtcgcag
gacgcgttcgacgagatccgtcgcgtgttccccgcgattcgcctcgtcaacggctacggg
ccgaccgaaaccgtgatctcgccgatgctctggccggtcgcgccgggcacgacgcccgcg
ctcgacgcgggtaacggctacgcgtcgctgccgatcggctggccgatcggccggcgcgtc
gcgcgcgtcgagcgcgccgacggcacggtcgcgcgcggcgaagcgggcgagctgctgctc
ggcggcgcgtgcctcgcgcgcggctatcacggccgcgccgcgctgacggccgagcgcttc
ctgccggatccggcgggcgagcccggcgcgcggatctaccgcacgggcgacctcgcgcgc
gagcgcgcggacggcgcgttcgactatctcggccggatcgacgaccaggtgcaggtgcgc
ggcgtgcgcgtcgagccggccgagatcgccgcgtgcctgctcacgcatccgggcgtgcgc
gacgcgggcgtgctcgccgagacggcgggcgggcgcacgcaactgatcgcgtgcgtcgcg
ctcgcggccccgccgcgcgaaacgccgtccggcggcgatgcgccgccggacgacgacgcg
ctgcgcgcgcatgtggccgcgcatctgccggccgcgtggctgccgcaccggttcgtgcgc
ttcgacaagctgccgtacacgctgaacggcaagctcgaccgcgtcgcgctgcgcgacgcg
gtcgcggcgcggccggccgaggccgccgcggatgtcgacgcgccgcgcaccgacaccgag
cgccgcgtcgccgcgctctggcagcggctcctgaacgacccggcgccgatcggccgcgtc
gaccgcttcttcgcgcgcggcggcgattcgctcgccgcgatgcaactgcagacggcgatc
cggctcgactggcgcgtgaacctgcggctcgacacgctcttcgacgacgcgccgctcgcc
gagctcgccgcgcgcatcgatgcggccgagcgcgaagcgcggcagccggccgcgatcggg
acgacggcgcggcgcgcgatcgcggccgatgcaatcgacgcgcgcgcgacgggcgacgcg
cgcgcgacgggccagatgggcaggacgggcgcggcgggtgaggcgaccgaggcggccggc
gcgctcgagcgtcccgcttcgttcgcgcagcaacgcttctgggtgctcgcgcgcacgcag
gacgccggggccgcgtatcacgtgtcgttccactgggacatcgacggcgcgctcgacctc
ggcacgctgcagcgcgcgctcgacatgctgatcgcgcgccacgaggcgtggcgcacgacg
ctcgtcgagaacgacgacggcgtcgtcctccagcgcatccatgcggcgctgccggtgcgg
atcgccgccgtcgacctgcgcggcgaggccggcgcgtcgcgcgccgcgcgtcttgccgag
ctgaccgagcgccatgcgggcgcgccgttcgatctgtccgacggcccactcgtgcgcgcg
ctgctcgtcacgctcgccgacggcgcgcagcgtttcctgctgacgacgcaccacgcggtg
agcgacggctggagctcgcgctgcgcgttcgccgagctgacggccgcctacgcggcactc
gccgaaggccgcgcgcccgagctgccggcgctgccgatccagtatgcggattacgcgcaa
tggcagcgcgacgcgctcgatgcgcacgagaccgcgcgcgagctcgcctactggcgcggc
gcgctcgacggcgcgcccgcgccgctcgcgctgccgctcgaccgcccgcgcgcggccgag
cgcgactatcgcggcggccggctcgcgcggcgtctgtcgcccgccgcgtcggacgcggtg
cgcgccgccgcgcggcggctgcatgcgtcgccgtttacggtgctgctcgccgcgttcgac
gcgtggctctttcgcctgacgggcgagcgcgatctcgtcgtcgccgcgccgatcgcgcag
cgcgcgcggccggaaaccgcgccgctcgtcggcctgttcctcaacacgctcgcgctgcgc
gcgcgcgtgtcgcccgcgcagtcgttcgaatcgctcgtcgcctcggtgcgcgacgccgcg
ttcggcgcgttcgcgcatcaggacgtgccgttcgacaaggtgatcgacgctgtgaagccc
cccgtgcggcgcggcgacgagtggctgcgcgtgaagttcgcgcagcagttcgatctggag
tgccgcgcgtcgctgccgggcgcggccgtgcggatggcgccgggcctcgacacggccgcg
cgcttcgattacgcgctcgatttcaccgacgacccgcgcggcatcgaattcgtcgctgct
tacgcgcgggacgggatcgacgaggcgaccgcgcacgcctggctcgacagcttcgccgcg
ctcgtcgaggacgcggtgcgcgagccgcgccgcccgatcgccgcactcgcggttgcgcag
gccggcgcgccgtgcgcgctcatcgccggccggccgctcgcgaccgcgccggacgtgctc
gcgctcttcgcgcgcgaggcggccgagcatccgcatcgcgtcgcgctcgcggatgccgac
acgcggctcacgttcgccgagctcgacgacgcgtcgaaccgcgtcgcgctcgcgctgcgg
cgcgacgccgcgcgcgacgaagcgcccggcgcggaaacgcccgtcgcgatctgcatcgag
cgttcggcgcgcttcgtcgtcgcgttcctcggcgtgctgaagtcgggcgcgtacgcggtg
ccgctcgatccggcgtcgccgcgcgagcggatcgccgcggcgctcgccgcgtgcggcgcg
tgccggatgctcgcggcaggcgcgctcgacgcgctcggcgagttcgacggcgtcgcggtg
caggacatcgacgcatgcgggcacgacgcgtcgctcgcgaacgcggccgcgccgcgcgtg
ccgccgcagccggagcaggccgcgtatctgattttcacgtcgggctcgacgggcgcgccc
aagggcgtcgtcgtgccgcatcgcgcgctcgccgactacgtcgccgggatgctcgacgag
ctcgcgttcgcgccgcacgcgtcgatggcgatggtgtcgacggtcgcggccgacctcggc
cacacgacgctgttcggcgcgctgtgctcgggccgcacgctgcatctgctgcccgcgcaa
gcggcgttcgatcctgaccgcttcgcgcacgaaatggcgacgcgcaaagtcggcgtgctg
aagatcgtgccgagccatctgcacgcgctgctcgacgcgcagcgcgcggccgacgtgctg
cccgcgcacgcgctcgtcacgggcggcgaggcgctgccttgggcgctcgtcgagcgcatc
gccgcgctgaagccggactgccgcgtgatcaatcactatgggccgaccgaggcgagcgtc
ggcgcgctcgtgtgcgacacgtccgcacccgcgcaggcggacctgcgcgcggccgccgcg
tcgtcgcccggcgaagcggcgcgcggcgtgccgctcggccggccgctgccgaacgcgcac
gcatgcgtgctcgacgcgtacggctcgagcgtgcccgtcggcgcgatcggcgaactgtac
ctcggcggcccgggcctcgcgcgcggctatctgggccgcgcggcggcgagcgccgagcgc
ttcgttccgcacccgcacgtggcgggcgcgcgcgtctaccggacgggcgaccgcgtgcgg
ctgcgcgccgacggccggctcgatttcctcgggcgtctcgacgaccaggtgaagatccgc
ggctaccgggtcgagcccggcgaggtgagcgccgcgctgcgcgcgctgcccggcgtcgcg
caagcagaaacgctcgcgctcgagcacgaagggcggctgcgcctcgccgcgttcgcgacg
cccgaggccggcgcgcggatcgcggccgatgcgctgcgcgacgcgctcgccgcgcgcctg
cccgactacatggtgcccgccgcgctcgtcgtgctcgacgcgctgcccgtgaccgcgaac
ggcaagatcgatcgcgcggcgctgcgcgcgcgcgcggcggcgcccgcgccggcgacggcg
ggcgacgaggacgcgccgcaaggcccgatcgaggcgacgctcgccgaggtctggcgcgac
gtgctgaaggcggcgcgcgtcggccgccacgacaacttcttcgagctcggcggcgattcg
attctcgtgctgcaggtgatcgcgcgcgcgcgcaagcgcggcgtcaagttcacgccgaag
cagttgttcgacggcccgacgctcgccgagctcgcgcgcgtcgccgtggcgatcgaggcc
gccgcgccggcgagcggcgcggcgcatggcgcggccatcggcgcgaatgccgccgccgcc
cgccgcgacgaagcggtgctcacgcccgcgcaactgcgcttcttcgcgctcgatattccg
cgccgcggccactggaatcagtcgatcgcgctcgacgtcgccggcgcgttcgatttcgac
gccttcgcgcgcgcgttcgacgcgttgctcacgcaccacccggtattccgcgaacgcttc
gcgccgacgggcgacggcggcgggtggcagcgctcggccgcgccgcgcgcgttcgacacg
ctgccgctcgcggccgccgccgcgcgcgacgaagcggatgcgctcgcgcagttcgacgcg
ctgcaagccacgctcgacctgacgcacggcccgctcgcgtgcgcgttcgccgcggtgctg
ccgagcggcgcgacgaagctgtatctggcgatccaccacgcgatcgtcgacggcgtgtcg
tggcgcgtgctgctcgacgatctcgacgccgcgtaccgcgccgcgtgcgagcgccgcgcg
gtgcggctcgggccgacgggcgcgagcgcgtccgaatgggcggcgcgtcttgcgcgcgcg
gcccgcgatccggccgggccgttcgcgggcgagctgccgtactgggcggcgctcgccgcg
ccgcacgacgatctgcggccggatcgcccggatgcggcggcgaccaacgcgcacgccgac
gtcgtgatccagacgctcgacgcggcgctcacgcgcgaagtgctcaccgacgcgaacgcc
gcgtaccgcacgcaggcggtcgagctgctgatcgcggcgctcgtcgccgcgctcggccaa
cacacgggcgcggccgcgtgccggctcgagctggaggggcacggccgcgaggcgctcttc
gacgagctcgacgcgagccgcacgctcggctggctgacgagccactatccggtggcgttc
gcggtggaggcgacgcccgccgcgacgctcgccggcgtgaaggatgcgctgcgcgcggtg
ccgaacaagggtctcggcttcggcgtgctgcgccactacggcgacgacgcgacgcgcgcc
gcgctcgcgcgggtcgcccgcccgcgcgtgacgttcaactacctgggccagttcgacgcg
ccgcgcgacgccgcgctcgtgccgcgcttcggcggcgcgggccgcgagcgcgatccggcg
gggccgctcggcaacgcgctcgcgatccacgcgtatgtcgacgcgaacggcgagcgcgcg
ctgaaggtgcactgggtgtacggcgcgacgcaattcgaccgcgcgacgatcgacgcgctc
gccgcgcggttcgacgccgcgctgcgcgcgctcgccgccgcgtgccgcgcgcgcgtcgcc
gagcgcggcgcgggcgcgacgcccggcgactatccgctcgcgcgcgcgggcggcctcacg
caggcggcgctcgaccggctgccgttcgatgcgcgcgcgatcgacgacatctatccgctg
tcgccgatgcagcagggcatactgttccattcgctgttcgcgccggagcgcgcgacgtac
gtgaaccagctcgtcgcgacgctcgtcgatcccgacgtcgagcggctgcgcgccgcgttc
gacgcggccgtgccgcgccacgacatcctgcgcaccggcttcgccgcccacgaggcggcg
ccgatgcagatcgtccaccgccacgcgcgcatgccggtcgagatcgtcgactggcgcggc
gcgcatgcgtcgcccgcggcgctcgacacggcgctcgacgcctggctcgccgccgaccgc
gcgcgcggcttcgatctcgcggcgccgccgctgatgcgcgtgacgctgatccgcacggac
gacgccgactggcggctcgtctggacccgccaccatctgctgctcgacggctggagcacc
gcgcgcctgttcgcggacgtgctgagcgactacatcgagccgccgcgcgcgaatccgttc
gccgcgccggcgcgcacgcgctaccgcgatttcatcgcgtggctcgcgcggcgcgatgcg
caggcggaccgcgcgttctggctcggccgcctcgcacggctcgacgagccgacgcacgtc
gccgagcgcgcgcgcggcgcgagcgccgcagcgcacgaggcggccggccgcgcgaactgg
cgcgcgacgctgcccgcggcggacaccgcgcgcatcggcgaagcggcgcgccgcatgaaa
gtgaccgtcaacacgatcgtgcagggcgcgtgggcgctcgcgctgcagcgcatcacgcac
cgccgcgcggtcgcgttcggcgcgacggtcgcgggacgcccgcacgcgctgcccgacgtc
gacaccgtgctcggcctgttcatcaacacgctgcccgtgatcaccgcgccgttgccgcag
ctcgccgcgcgcgactggctcgcgagcctgcagcgcgacaacgcggcggcgctcgagcac
gcgcacacgccgctctacgagatccagcagtgggcgggcctgggcggcgcgctgttcgac
acgctcgtcgtgttcgagaactacccggtcgacgaagcgtggcaggggcgcgatgcgcgc
gcgctgcaaaagcgcgacctgcgcaacatcgaggccaccgatttcgcggtgacgctcgtg
atcgaggcgggcgacacgctcgcgatcgactacggctacgatcccgcgcgcatcggcccg
gcgcgcgtcgaggcgctgcaccgcgcgttcgccgcatgcatcgcggggctcgtcgaccat
ccggacgcgccgctcggcacgatctcgtgcgcgagcgccgacgatctcgcgctgatcgcg
cgcgccaacgcgaccgagctcgactggcccgccgcgcagcgcgcgccgctgttcgcgcaa
ttcgaagcggccgcgcgcgcgcggcccgacgcgatcgcgctcgaatgcctcgcctcctcc
gacggcggcgacggcgcgcgcgcgcagatgcgctacggcgagctcgacgcgaaggcggac
cgcgtcgcggcggcgctcgccgcatccggcgtgcggcccgattcggtcgtcgcgctgtgc
gtcgagcgctcgttcgacatggtcgtcgcgctcgtcggcacgatgaaggcgcgcgccgcg
tacctgcccgtcgatcccgactatccggccgagcggatcgcgtatctgctcggcgacgcg
aagccgcccgtggtgatcacgcaggcgcatctgcgcgcgcgcgtcgacgcggcgctcgcg
ggcgcggatgccgccgtcgtcaccgtcgacgaactgctcgcgcgcgcggccggcgcggaa
cccgaagccgagcgcgtcgcggcggcggccgacgtcgcgcccgggcagctcgcgtacctg
atctacacgtccggctcgaccggccagccgaagggcgcgggcaacacgcacggcgcgctc
gcgaaccggatcgcctggatgcagcgcgcgtaccggctcgcgcccgacgacgtcgtgctg
cacaagacgccgttcggcttcgacgtgtcggtgtgggagttcgtctggccgctcgccgtc
ggcgcgaagctcgcgatcgcggcgccgggcgatcaccgcgatccggcgcgcctcgtcgcc
gcgatcgacgcacatcgcgtgacgacgctgcacttcgtgccgtcgatgcttgccgcgttc
gtcgcgtatctcgacgatttcggcgcggccgcgcgctgcgcgagcgtgcgcacgatcgtc
gcgagcggcgaggcgctcgcgcccgagctcgtcgcgcgcgtcgccgcgctgctgccgcac
gcgcagttgcacaacctgtacggcccgaccgaggcggcgatcgacgtgtcgcactggcgc
tgcacggccgacgacgccgcggccgacgcggtgccgatcggccacccgatcgcgaacctg
cgactgcacgtgctcgacgcggcgctgcacccggcgcccgtcggcgcgacgggggaactg
tacctgggcggcgccgggctcgcgcgcggctacctgggccgcgcggcgctgacggccgag
cgcttcgtgcccgatccgttcgtgccgggcgcgcgcctgtaccgcacgggcgacctcgcg
cggcggcgcgcggacggcgcgctcgactatctcggccgcctcgacacgcaggtgaagctg
cgcggccagcgcatcgagctcggcgagatcgaggcgctgctgcgcgcgacggacggcgtg
cgcgacgcggtcgtgatcgtgcgcgacgagcggctcgtcggctacgtcgcgtgcgcgacg
cccgccgggttcgacgcggccgcgcagatcgagcggctgcgcgcgcgactgcccgcctac
atggtgcccgcgcaactcgtcgcgctcgatgcgctgcccgtcacgccgaacggcaagtgc
gatcgccgtgcgctgccggcgcccgtgttcgacgcgcgcgtcgtcgacgcgccgcgaacc
gccaccgagcgcgcgctcgcggcgatctggcagcgcgtgctgacgctgccggagctcggc
cgcgacgacgatttcttcgcgctcggcggccattcgctgctcgccgcgcaggcgaacgcg
caggcgaacctgcagtggtcgctcacgctgccgctgcgcacgatcttcgacgagcgcacg
cttgcgcgctgcgcggcggcgatcgaccgcgcgcgcgacgccggccgcgagcgcgacgcc
gcgggcgcgatcgacgcgctgctcggcgagctcgaagcccagtaa

DBGET integrated database retrieval system