KEGG   Burkholderia mallei NCTC 10229: BMA10229_A1275Help
Entry
BMA10229_A1275    CDS       T00471                                 

Definition
(GenBank) ribonuclease II (RNB) family protein
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bml03016]
    BMA10229_A1275
Enzymes [BR:bml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     BMA10229_A1275
Transfer RNA biogenesis [BR:bml03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    BMA10229_A1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB TMEM61
Motif
Other DBs
NCBI-ProteinID: ABN03683
UniProt: A2S5P0
LinkDB All DBs
Position
I:complement(1297248..1299326)
Genome map
AA seq 692 aa AA seqDB search
MNVFFEESGSFKAGSVLSRQGDAFQVELPGGRRAKVRAKDVLIEFEKPAAGELMQQADEA
AQQIDLDFLWECAPAEEFAYAALADEYFGASYGPVERAALVLRLHGAPVYFRRKGRGQYQ
RAPEEQLKMALAGLERKRQQALVQAGYEEELKAGRLPDAFAGKALGLLTKPDKNSIEYKA
LDAAALARGVSPARLMLDCGGIPSARALHEARFLAEYFPHGTGFLAVAVGKLPEDLPRAD
VNAFSIDDITTTEIDDAFSVEHLSDGRVRIGVHIAAPALGIVRGDAVDAIARARLSTVYM
PGDKITMLPDDVVDVFTLKEGDYRPALSLYIIVKRDTQEIVANETRAEYVYVKSNLRHNT
LDELVTEDALAAGTGDYPHKDDIAALWPLAQALFERRQVARAGYGLKREVQRNTDYNFYV
EGEHVSITPRRRGSPLDLIVSELAILANSTWGAFLHDHSVPGIYRTQRAFGMPSGPKRTR
MQTSAAPHEGLGVPQYAWSTSPLRRYVDLVNQWQLLACVQHGVTAKLAAPFKQKDADLYA
VVQGFDDTYAAYADHQRRMEYFWCLRWIKQEGRKQVSATVVKGELVRLDEVPLLLHVPAL
GVHARGTRVLLDVMSVDELTIEASVRLVSVLDAPMVSSGEPADEDEDADAADETLLDAAD
ESAQGEAEALAEAGGAASGNGESSANGEEQSK
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgttttcttcgaggaatcgggcagtttcaaggcgggcagcgtgctgtcgcgccag
ggcgacgcgtttcaggtcgaattgccgggcggccggcgcgcgaaggtgcgcgcgaaggac
gtgctgatcgaattcgagaagcccgcggcgggcgagctgatgcagcaggcggacgaagcc
gcccaacagatcgatctggatttcctgtgggagtgcgcgcccgccgaggaattcgcgtat
gccgcgctcgccgacgaatatttcggcgcgagctacggccccgtcgagcgcgcggcgctc
gtgctgcgcctgcacggcgcgcccgtctacttccgccgcaaggggcgcggccagtatcag
cgcgcgcccgaggagcagctgaaaatggcgctggccgggctcgagcgcaagcgccagcag
gcgctcgtgcaagccggctacgaggaggagctgaaggcgggcaggctgcccgacgcgttc
gcgggcaaggcgctcggcctgctgacgaagccggacaagaactcgatcgaatacaaggcg
ctcgatgcggcggcgctcgcgcgcggcgtgtcgccggcgcgcctgatgctcgactgcggc
ggcattccgtcggcgcgcgcgctgcacgaggcgcgctttctcgccgaatacttcccgcac
ggcacgggctttctggccgtcgcggtcggcaagctgcccgaggatctgccgcgcgcggac
gtcaacgcgttctcgatcgacgacatcacgacgaccgaaatcgacgacgcgttctccgtc
gagcacctgtccgacgggcgcgtgcggatcggcgtgcacatcgcggcgcccgcgctcggc
atcgtgcgcggcgatgcggtcgacgcgatcgcgcgcgcgcggctgtcgaccgtctacatg
ccgggcgacaagatcacgatgctgccggacgacgtcgtcgacgtgttcacgctgaaggag
ggcgattaccgcccggcgctgtcgctgtacatcatcgtcaagcgtgacacgcaggaaatc
gtcgcgaacgagacgcgcgccgaatacgtctatgtgaagagcaacctgcggcacaacacg
ctcgacgagctcgtcaccgaggacgcactcgcggcgggcacgggcgattatccgcacaag
gacgacatcgcggcgctctggccgctcgcgcaggcgctcttcgagcgacgccaggtcgcg
cgcgcgggctacgggctcaagcgcgaagtgcagcgcaacaccgattacaacttctacgtc
gaaggcgagcacgtgtcgatcacgccgcgccggcgcggctcgccgctcgatctcatcgtg
tccgagctcgcgatcctcgcgaactcgacatggggcgcgttcctgcacgatcacagcgtg
ccgggcatttaccgcacgcagcgcgcgttcggcatgccgagcgggccgaagcgcacgcgc
atgcagacgagcgccgcgccgcacgaggggctcggcgtgccgcagtacgcgtggagcacg
tcgccgctgcgccgctacgtcgacctcgtcaaccagtggcaactgctcgcgtgcgtgcag
cacggcgtcaccgcgaagctcgccgccccgttcaagcagaaggatgcggatctgtacgcg
gtcgtgcagggtttcgacgacacgtacgccgcgtacgccgaccaccagcgccggatggag
tatttctggtgcctgcgctggatcaagcaggaaggccgcaagcaggtgagcgcgaccgtc
gtgaagggcgagctcgtgcgcctcgacgaagtgccgctgctgctgcacgtgcccgcgctc
ggcgtgcatgcgcgcggcacgcgggtgctgctcgacgtgatgtcggtcgacgagctgacg
atcgaggcgtcggtacggctcgtgagcgtgctcgatgcgccgatggtgtcgagcggcgag
ccggccgacgaagacgaggacgccgacgcggccgacgagacgctgctcgacgccgccgac
gaatcggcgcaaggcgaagcggaagcgctcgccgaggcgggcggcgcggcgagcggcaac
ggcgaatcgtccgcgaacggcgaggaacaatcgaaatga

DBGET integrated database retrieval system