KEGG   Burkholderia mallei NCTC 10229: BMA10229_A1452Help
Entry
BMA10229_A1452    CDS       T00471                                 

Definition
(GenBank) AMP-binding domain protein
Organism
bml  Burkholderia mallei NCTC 10229
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ABN03407
UniProt: A2S666
LinkDB All DBs
Position
I:1482424..1484157
Genome map
AA seq 577 aa AA seqDB search
MAPLAEGRNCRAHGVGTLDESGIERVLSYRQLSEAGLRMSAALNALGARAGDIALVALPA
TGDYLALLVGCVLSGVVPCTVPPPLKRASGSGPQVLEVACRLYRPRFVFTASAHVAELEA
QLRDTGARVIDVGILHAASTGAEPRLALRGAGDTHHIQLTSGSTSHPKAAVISHRNVAAN
IAGIANACGYSKHAADNTVIWLPLHHDMGLVSLLLHLYYRTSLRLMPSMSFVRNPLGWLR
RIAHARSTIAVAPTFALRYCVRRFNAATMDGADFSHLRTFLVGAERVDRATLSDFASTFA
PYGLHASALQPCYGMAEATLAVTLHRSFDTPNAPAFTHVIADRIDTATLARHRRAAPAPD
GHTGATDTLLAVGAPLDDMAYEIRDAQGRLAAEREAGEIFIRGASVMQGYLPSAGAPAPQ
PFDAHGWFATGDIGYVSGGQLFILGRKKEIIIIRGTNYFPHEIEETIDSHPAVYKGACIA
VGIHDETQGTENLVVLVEAHANHVSRDSRAELQARMQQRLGYCAQRIAFVEPGALPRTTS
GKPQRLKARAMFVSGELREIAPPPSRRADADRVAPYP
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
ttggctccgctcgcagagggtcggaactgccgcgcgcacggcgtcggcacgctcgacgaa
agcggcatcgagcgcgtgctgtcctaccggcaactgagcgaagcgggcctgcgcatgagc
gccgcgctgaacgcgctcggcgcgcgcgcgggcgatatcgccctcgtcgcgctgcccgcg
acgggcgactatctcgcgctcctcgtcggctgcgtgctgtcgggcgtcgtgccgtgcacg
gtgccgccgccgctcaagcgcgcgagcggctcgggcccgcaggtgctcgaagtcgcgtgc
cggctctatcgcccgcggttcgtgttcacggcgtccgcgcacgtcgccgagctcgaggcg
caactgcgcgacacgggcgcgcgcgtgatcgacgtcggcatcctgcatgcggcgtcgacg
ggcgccgagccgcggctcgcgctgcgcggcgccggcgacacgcatcacatccagctgacg
tccggctccacctcgcatccgaaggcggccgtcatcagccatcgcaacgtcgcggccaac
atcgccggcatcgcgaacgcgtgcggctacagcaagcacgccgccgacaacaccgtgatc
tggctgccgctgcatcacgacatgggcctcgtcagcctgctgctgcatctgtattacagg
acgtcgctgcggctgatgccttcgatgagcttcgtgcgcaatccgctcggctggctcagg
cgcatcgcgcacgcgcgctcgaccatcgccgtcgcgcccaccttcgcgctgcgctactgc
gtgcgccgcttcaacgcggcgacgatggacggcgcggacttcagccatctgcgcacgttc
ctcgtcggcgcggagcgggtcgatcgcgcgacgctgtccgatttcgcgtcgacgttcgcg
ccgtacggcttgcacgcatcggcgctgcagccgtgctacggaatggcggaggcaacgctc
gccgtcacgctgcaccgctcgttcgacacgccgaacgcgccggcgttcacgcacgtgatc
gccgatcgcatcgacaccgcgacgctcgcgcggcaccgccgcgccgcccccgcgcccgat
ggccacacgggcgcgaccgacacgctgctcgccgtcggcgcgccgctcgacgacatggcc
tacgagatccgcgacgcgcagggccggctcgccgccgagcgcgaagcgggcgaaatcttc
attcgcggcgcatcggtaatgcagggctatctgccgagcgccggcgcgcccgcgccgcag
ccgttcgacgcgcacggctggttcgcgacgggcgacatcggctacgtgagcggcgggcag
ctcttcatcctcgggcgcaagaaggaaatcatcatcatccgcggcacgaactactttccg
cacgagatcgaggagacgatcgacagccatccggccgtctacaaaggcgcctgcatcgcg
gtgggcattcacgacgagacgcagggcaccgagaacctcgtcgtcctcgtcgaggcgcac
gcgaatcacgtgagccgcgattcgcgcgccgagttgcaggcgcgcatgcagcagaggctc
ggctactgcgcgcagcgcatcgcgttcgtcgagccgggcgcgctgccgcgcacgacgagc
ggcaaaccgcaacggctgaaggcgcgcgcgatgttcgtgagcggcgagctgcgcgagatc
gcgccgccgccgtcgcgccgcgccgatgccgatcgcgtcgcgccgtacccgtga

DBGET integrated database retrieval system