KEGG   Burkholderia mallei NCTC 10229: BMA10229_A1552Help
Entry
BMA10229_A1552    CDS       T00471                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00010  Glycolysis / Gluconeogenesis
bml00620  Pyruvate metabolism
bml01100  Metabolic pathways
bml01110  Biosynthesis of secondary metabolites
bml01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10229_A1552
   00620 Pyruvate metabolism
    BMA10229_A1552
Enzymes [BR:bml01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BMA10229_A1552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABN03812
UniProt: A2S6G4
LinkDB All DBs
Position
I:1588406..1590025
Genome map
AA seq 539 aa AA seqDB search
MHRGAACWHGFVVTNGVAHVARRITDTDMRGATMNHADMQHLNIEFPYRKQYGNFIGGEW
VAPVGGEYFDNVSPVTGRPFTAIPRSREADIELALDAAHAAKAGWAAKGAAERANVLLRI
ADRMEANLTRLAVAETIDNGKPLRETTAADVPLAIDHFRYFAGCIRAQEGSIADIGGDMV
AYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALAAGNCVVLKPAEQTPASILVFAELIQDL
LPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTGETSTGRLIMQYASENLIPVTLELGGKS
PNIFFADVMDRDDSYFDKALEGFAMFALNQGEVCTCPSRALVEESIYDRFIERALKRVEA
IKQGHPLDSQTMIGAQASAEQLEKILSYIDIGRGEGAQCLTGGERNVLGGELAEGYYVKP
TVFRGHNKMRIFQEEIFGPVLAVTTFKTEEEALEIANDTLYGLGAGVWTRDGNRAYRFGR
GIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcggcgcggcgtgctggcacggttttgtcgtaacgaacggcgtcgcgcacgtc
gcgcggcgcatcaccgataccgacatgcgaggagcaacgatgaatcacgcggacatgcaa
catctgaacatcgaattcccgtaccgcaagcagtacgggaatttcatcggcggcgaatgg
gtcgccccggtcggcggcgagtatttcgacaacgtctcgcccgtcaccggccggccgttc
accgcgatccctcgctcgcgcgaagccgacatcgagctcgcgctcgacgccgctcacgcg
gccaaggcgggctgggccgcgaagggcgcggccgagcgcgcgaacgtgctgctgaggatc
gccgaccggatggaggcgaacctcacgcgcctcgccgtcgccgagacgatcgacaacggc
aagccgctgcgcgaaaccaccgcagccgacgtgccgctcgcgatcgaccacttccgctac
ttcgcgggctgcatccgcgcgcaggaaggctcgatcgccgatatcggcggcgacatggtg
gcctaccacttccacgagccgctcggcgtcgtcggccagatcatcccgtggaacttcccg
ctgctgatggccgcgtggaagctcgcgccggcgctcgcggccggcaactgcgtcgtgctc
aagccggccgagcagacgcccgcgtcgatcctcgtgttcgccgagctgatccaggatctg
ctgccgcccggcgtgctcaacatcgtcaacggcttcggcctcgaggccggcaagccgctc
gcgtcgagcaagcggatcgcgaagatcgcgttcacgggcgagacgtcgacgggccgcctc
atcatgcagtacgcgagcgagaacctgattcccgtcacgctcgagctgggcggcaagagc
ccgaatattttcttcgccgacgtgatggatcgcgacgacagctacttcgacaaggcgctc
gaaggcttcgcgatgttcgcgctgaaccagggcgaagtctgcacgtgcccatcgcgcgcg
ctcgtcgaggagagcatctacgatcgcttcatcgaacgcgcgctcaagcgcgtcgaggcg
atcaagcagggccatccgctcgattcgcagacgatgatcggcgcgcaggcgtcggccgag
cagctcgagaagatcctgtcgtacatcgacatcggccgcggcgaaggcgcgcaatgcctg
acgggcggcgagcgcaacgtgctcggcggcgagctcgccgaaggctattacgtgaagccg
accgtgttccgcggccacaacaagatgcgcatcttccaggaagaaatcttcgggccggtg
ctcgcggtgacgacgttcaagaccgaggaggaagcgctcgagatcgcgaacgacacgctg
tacggcctgggcgccggcgtctggacgcgcgacggcaaccgcgcgtaccgcttcggccgc
ggcatccaggcgggccgcgtgtggacgaactgctatcacgcgtatccggcgcacgcggcg
ttcggcggctacaagcaatccggcatcggccgcgagacgcacaagatgatgctcgaccac
taccagcagacgaagaacctgctcgtcagctacagcgaaaagccgctcgggttcttctga

DBGET integrated database retrieval system