KEGG   Burkholderia mallei NCTC 10229: BMA10229_A1906Help
Entry
BMA10229_A1906    CDS       T00471                                 

Gene name
tuf-1
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bml  Burkholderia mallei NCTC 10229
Brite
Translation factors [BR:bml03012]
 Eukaryotic Type
  Elongation factors
   BMA10229_A1906 (tuf-1)
 Prokaryotic Type
   BMA10229_A1906 (tuf-1)
Mitochondrial biogenesis [BR:bml03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BMA10229_A1906 (tuf-1)
Exosome [BR:bml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BMA10229_A1906 (tuf-1)
  Exosomal proteins of breast cancer cells
   BMA10229_A1906 (tuf-1)
  Exosomal proteins of colorectal cancer cells
   BMA10229_A1906 (tuf-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABN01100
UniProt: A2S7F9
LinkDB All DBs
Position
I:1938680..1939870
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSAKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGIKATAKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagtttgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagcgatcgcgacggtgctgtcggcgaagttc
ggcggcgaagcgaagaagtacgacgaaatcgacgcggcgccggaagaaaaggcgcgcggc
atcacgatcaacaccgcgcacatcgagtacgaaacggcgaaccgccactacgcacacgtg
gactgcccgggccacgccgactacgtgaagaacatgatcacgggcgcggcgcagatggac
ggcgcgatcctggtgtgctcggccgctgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggtcggtgtgccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgcggagctgctcgagctggtcgaaatggaagtgcgcgaactgctgtcgaag
tacgacttcccgggcgacgacacgccgatcatcaagggttcggcgaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggcgatcatgaacctggccgacgcgctggacacg
tacatcccgacgccggagcgtgcggtcgacggcgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgtggtacggtggtgacgggtcgtgtcgagcgcggcgtgatcaag
gttggcgaggaaatcgaaatcgtcggtatcaaggcgacggcgaagacgacctgcacgggc
gtggaaatgttccgcaagctgctggaccagggtcaggcgggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgcggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggcagaagtgtacgtgctgagcaaggacgaaggcggc
cgccacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgcgccgatcgcgatggaagaaggtctgcgcttcgcgatccgc
gaaggcggtcgcaccgtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system