KEGG   Burkholderia mallei NCTC 10229: BMA10229_A2125Help
Entry
BMA10229_A2125    CDS       T00471                                 

Definition
(GenBank) ATP-dependent protease domain protein
  KO
K01338  ATP-dependent Lon protease [EC:3.4.21.53]
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bml01002]
    BMA10229_A2125
Enzymes [BR:bml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     BMA10229_A2125
Peptidases [BR:bml01002]
 Serine Peptidases
  Family S16: lon protease family
   BMA10229_A2125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA AAA_5 AAA_2 AAA_16 RNA_helicase AAA_22 IstB_IS21 AAA_3 TsaE AAA_33 AAA_24 NACHT RuvB_N TIP49 AAA_18 MCM Sigma54_activat Bac_DnaA Sigma54_activ_2 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: ABN02204
UniProt: A2S820
LinkDB All DBs
Position
I:complement(2148610..2149590)
Genome map
AA seq 326 aa AA seqDB search
MTTAMVKQELAVASFSTVYDIERIETALNDLNEGASDALRATYEKMLKTGNLRFCVKPTR
MPAFDSLAQALPNFAEPLDDVRKQVALCLETDDRLELMPILLLGEPGIGKTHFAKALAKM
LGTAYHYVPMSSLTAGWVLSGASSQWKNAKPGKVFDALVNGCYSNPVIAIDEIDKAGSDA
QYDPLGALYALLEHDTASAFVDEFAEVPIDAGNVIWIATANDASAIPEPIMNRMNVYEIE
PPDASGARRIAQTIYGEIRNAHAWGQRFPAALGDDALDVLAAMPPRTMRRVLLHAFGAAR
LDGRDAVAPRDIRTDESAGRRRPIGF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggcgatggtgaaacaggaactggcggtggcttcgttcagcacggtctacgat
atcgagcgaatcgagacggcgctgaacgatctgaacgaaggcgcgagcgatgcattgcgc
gcgacctacgagaagatgctgaagacgggcaatctgcgcttttgcgtgaagccgacgcgc
atgcccgcgttcgattcgctcgcgcaggcgttgccgaacttcgccgagccgctcgacgac
gtgcgcaagcaggtggcgctgtgcctcgagaccgacgatcgcctcgaattgatgccgatc
ctgctgctcggcgagccgggcatcggcaagacgcatttcgcgaaggcgctcgcgaagatg
ctcgggaccgcttaccactacgtgccgatgagctcgctcacggcgggctgggtgctctcg
ggcgcgtcgtcgcagtggaagaacgcgaagccgggcaaggtgttcgacgcgctcgtcaac
ggctgctattcgaacccggtgatcgcgatcgacgagatcgacaaggcgggcagcgacgcg
cagtacgatccgctcggcgcgctgtatgcgcttctcgagcacgacaccgcgagcgcgttc
gtcgacgaattcgccgaggtgccgatcgacgcgggcaacgtgatctggatcgcgaccgcg
aacgacgcgagcgcgattcccgagccgatcatgaaccggatgaacgtgtacgagatcgag
ccgcccgatgcgtcgggcgcgcgccgcatcgcgcagacgatctacggcgagatccgcaac
gcgcacgcgtgggggcagcgctttcccgccgcgctcggcgacgacgcgctcgacgtactc
gccgcgatgccgccgcgcacgatgcgccgcgtgctgctgcatgcgttcggcgcggcgcgg
ctcgacgggcgggacgcggtcgcgccgcgcgacatccgcaccgacgagagcgcggggcgg
cgccgtccgatcggcttttga

DBGET integrated database retrieval system