KEGG   Burkholderia mallei NCTC 10229: BMA10229_A2505Help
Entry
BMA10229_A2505    CDS       T00471                                 

Definition
(GenBank) AMP-binding enzyme domain protein
Organism
bml  Burkholderia mallei NCTC 10229
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ABN01830
UniProt: A2S944
LinkDB All DBs
Position
I:complement(2546909..2548474)
Genome map
AA seq 521 aa AA seqDB search
MTIEFSPGAAIDADALLDTLPQRIAALPARVAEHAPDHVALIEDGRRLTYAQLARAVEAA
AERLRGLGVRGGDRVMIVAENSIAQIVLLFAATRLDAWAIVSNARLSAAELDAIATHAQP
RLIAFVTGTSPDARAHADRRNAHAAAPFELDIGAWSHTVEAGTRAEPVEAHGARQCAALV
YTTGTTGAPKGVMLSHRNLLFVAAVSSMQRRVAPTDVVYAVLPISHVYGLASVCLGSLYA
GATLRLAPRFSPETLRRALADEGVTIFQGVPAMHAKLLEHLRAHGHAWRAPHLRFVYSGG
SPLDADLKARVERAYGLPLHNGYGMTESSPTIAQTPIDAPRADCSVGAPIPGVAVRFCSA
DGADVAPGEVGELWVRGPNVMLGYYRDPEGTRAAVTAHGWLKTGDLARAGTDGAMTIVGR
SKELIIRSGFNVYPSEVEQALNAHPDVVQSAVIGRAAEAGNEDVIAFVELAPNAAATESD
LKEWCVGRLAPYKRPVQIRALDALPAASTGKVLKHRLRAML
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgagttttcccccggcgcggcaatcgacgccgatgcgctgctcgacacgctg
ccgcagcgaatcgccgcgctgcccgcgcgcgtggccgagcatgcgcccgatcacgtcgcg
ctgatcgaggacggacgccggctcacgtacgcgcagctcgcgcgcgcggtcgaggccgcc
gccgagcgcctgcgcggcctcggcgtgcggggcggcgaccgcgtgatgatcgtcgcggag
aacagcatcgcgcagatcgtgctgctgttcgcggcgacacggctcgacgcgtgggcgatc
gtatcgaacgcgcgcctctcggcggccgagctcgacgcgatcgccacgcacgcgcagccg
cggttgatcgcgttcgtcaccggcacgtcgcccgatgcacgggcccacgccgatcggcgc
aatgcgcatgcggccgcgccgttcgagctcgatatcggcgcatggtcgcacacggtcgag
gcgggcacgcgcgcggagccggtcgaagcgcacggcgcgcgccagtgcgcggcgctcgtc
tatacgaccggcaccaccggcgcgccgaagggcgtgatgctgtcgcaccgcaacctgctg
ttcgtcgccgcggtatcgagcatgcagcggcgcgtcgcgcccaccgacgtcgtctacgcg
gtgttgcccatatcgcacgtatacgggctcgcgtcggtctgcctcggcagcctctacgcg
ggcgcgacgctcaggctcgccccccgcttctcgccggaaacgctgcgtcgcgcgctcgcc
gacgagggcgtgacgatcttccagggcgtgccggcgatgcacgcgaaactactcgagcat
ctgcgcgcgcacgggcacgcgtggcgcgcgccgcatctacgcttcgtctactcgggcggc
tcgccgctcgatgccgatctgaaggcgcgcgtcgaacgcgcttacggcctgccgctgcac
aacggctatgggatgaccgaaagcagcccgacgatcgcgcaaacgccgatcgacgcgccg
cgcgccgattgctcggtgggcgcgccgatcccgggcgtcgccgtgcgtttttgctcggcg
gacggcgccgacgtcgcgccgggcgaagtcggcgaactctgggtgcgcgggccgaacgtg
atgctcggctattaccgcgatccggagggcacgcgcgcggccgtcacggcgcacggctgg
ctgaagacgggcgacctcgcgcgcgcgggcaccgacggcgcgatgacgatcgtcggccgc
agcaaggaactgatcatccgttcgggcttcaacgtctatccgtccgaagtcgagcaggcg
ctgaacgcgcatccggacgtcgtgcagtcggcggtgatcgggcgcgcggccgaagcgggc
aacgaggacgtcatcgcgttcgtcgagctcgcgccgaatgcggccgcaaccgaaagcgac
ctgaaggaatggtgcgtgggccgacttgcgccctacaagcggcccgtgcaaattcgcgcg
ctcgatgcgctgccggccgcgtcgaccggcaaggtgctcaagcaccggttgcgcgcgatg
ctatga

DBGET integrated database retrieval system