KEGG   Burkholderia mallei NCTC 10229: BMA10229_A3267Help
Entry
BMA10229_A3267    CDS       T00471                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00061  Fatty acid biosynthesis
bml00780  Biotin metabolism
bml01100  Metabolic pathways
bml01212  Fatty acid metabolism
Module
bml_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BMA10229_A3267 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BMA10229_A3267 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bml01004]
    BMA10229_A3267 (fabZ)
Enzymes [BR:bml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BMA10229_A3267 (fabZ)
Lipid biosynthesis proteins [BR:bml01004]
 Fatty acid synthase
  Component type
   BMA10229_A3267 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ABN03408
UniProt: A2SB84
LinkDB All DBs
Position
I:3320948..3321415
Genome map
AA seq 155 aa AA seqDB search
MSTEKINFDIHKILTLLPHRYPILLVDRVLELEPHKAIKALKNVTVNEPFFTGHFPKRPV
MPGVLIIEALAQAAALLTFAEAQPKDPENTLYYFVGIDNARFKRVVEPGDQLILNVTFER
YIRGIWKFKAVAEVDGKVAAEAELMCTVKTADAAP
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaaaaatcaacttcgacattcacaagatcctcacgctgctgccgcaccgc
tatccgattctgctcgtcgatcgcgtgctcgaactcgaaccgcacaaggccatcaaggcg
ctgaagaacgtgacggtcaacgagccgttcttcaccggccacttcccgaagcggccggtg
atgccgggcgtgctgatcatcgaggcgctcgcgcaggcggccgcgctcctcacgttcgcc
gaggcgcagccgaaggatccggagaacacgctgtattacttcgtcggcatcgacaacgcg
cgcttcaagcgcgtcgtcgagccgggcgaccagttgatcctgaacgtgacgttcgagcgc
tatattcgcggcatctggaagttcaaggccgttgcggaagtggacggcaaggtcgcggcg
gaagccgagctgatgtgcacggtcaagacggccgacgcggcgccctga

DBGET integrated database retrieval system