KEGG   Blattabacterium sp. (Mastotermes darwiniensis): MADAR_182Help
Entry
MADAR_182         CDS       T01642                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bmm  Blattabacterium sp. (Mastotermes darwiniensis)
Pathway
bmm00564  Glycerophospholipid metabolism
bmm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MADAR_182 (glpA)
Enzymes [BR:bmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MADAR_182 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 Pyr_redox_3 HI0933_like NAD_binding_8 Thi4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AER40498
UniProt: G7SPN9
LinkDB All DBs
Position
188960..190540
Genome map
AA seq 526 aa AA seqDB search
MKNFLNRNRFLSILENRKIWDMVIIGGGATGLGIALDSASRGYKTLLLEQSDFSKGTSSR
STKLIHGGIRYLSQGNIKLVYEALQERGFLLKNAPHLVKKKRFVIPIFSWRMGLLYWIGL
KIYEWLAGSLSFGKSQFLSKNETIKIFPEIRQKSLKGGILYYDGQFDDARLAINIAQTCV
HKGGVLLNYFQVKNLIKKIGNKISGVIAYDLETKKKYSIHSKTVVNATGVFSNNISKMDE
STWPIFIRPSQGTHIVLKKSFFSSSDAIVIPKTSDGRILFSIPWYDHVLIGTTDTFLEES
VLEPKPLEKEIDFILHTFKKYFVFHPKKKDILSVFSGLRPLVVPPNSSSTTSTKDISRSH
KLIISPSGLVTIIGGKWTTYRKMAEETVNKAIEIGRLNKVPSVTKNIKIFGYSTSFFKST
DGKKELYIKKLIEENPLWGDPLISQSPYYCIKAEVIWMVRHEMARTIEDVLARRFRLLFL
NARKAIDIAPIVAELMAQELSRDEKWKKSQIASFKDLAMHYYYPIQ
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttttaaatagaaatagatttctaagtattttagaaaatagaaagatttgg
gatatggtcattatcggaggaggagctacaggtttaggtattgctttggattcagcttct
agaggatataagactctacttttagaacaatctgatttttctaaaggaacttctagtcgt
agtacaaaattaatccacggaggaatacgatatttatctcaaggaaatataaaattagta
tatgaagccttacaggaaaggggttttttgttgaaaaatgctcctcatttggttaaaaaa
aaacgatttgttattccaatttttagttggagaatgggtttattgtattggattggttta
aaaatttatgaatggttggctggatcattgagttttggaaaatcacaatttttatctaaa
aatgaaactatcaaaatatttcctgaaattagacaaaaaagtttgaaaggaggtattttg
tattatgatggacagtttgatgatgctcgtctagctattaatatagctcaaacttgtgtt
cataaaggaggtgtattgttaaattactttcaagtaaaaaatcttattaagaaaatagga
aataagatatctggggtaatagcttatgatcttgaaactaaaaaaaaatattctattcat
tcaaaaacagtagtcaatgctactggggttttttccaataatatttcaaaaatggatgaa
tctacatggcctattttcataagacctagtcaaggaacgcatattgtattaaaaaaatct
ttttttagcagttctgatgctatagtgataccaaaaacttctgatggaagaattctgttt
agcattccatggtatgatcatgttctaataggaactacagatacttttttagaagaaagt
gttcttgaacctaaacctctagaaaaagaaatagattttattttgcacacttttaaaaaa
tattttgtatttcatccgaaaaaaaaggacatattaagtgttttttctggattacgtcct
cttgttgtacctcctaattcatcttctactacttccactaaagatatttctagatctcat
aaactaataattagtccttctggattagtaaccatcataggtggaaaatggactacatat
agaaaaatggcggaagaaacggtcaataaagctatcgaaataggaagattaaataaagtt
ccttctgtaaccaaaaatataaagatttttggttatagtacctctttttttaaaagtact
gatggaaaaaaagaattgtatattaaaaaattaattgaggaaaatcctttatggggagat
ccattgatatctcagtctccttattattgtataaaagcagaagttatatggatggttcgt
catgaaatggctagaacaatagaagatgttttagcaaggaggtttcgtttattgtttttg
aatgctaggaaagctatagatatagccccaatagtagcagaattaatggctcaagagctt
tctagagatgaaaagtggaaaaaatcacagatagcttcttttaaagatttagctatgcat
tattattatcctatccagtag

DBGET integrated database retrieval system