KEGG   Burkholderia mallei NCTC 10247: BMA10247_0756Help
Entry
BMA10247_0756     CDS       T00479                                 

Gene name
rbn
Definition
(GenBank) tRNA-processing ribonuclease BN
  KO
K07058  membrane protein
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BMA10247_0756 (rbn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB MarR CLAG HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ABO04705
LinkDB All DBs
Position
I:738321..739631
Genome map
AA seq 436 aa AA seqDB search
MPKLSVDLDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFA
SFQNSLQGFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIVLVFTAVMMMTIESAFN
LIWRVRKPRPFAQRVLAYWALITLGPLLFGVSLSMSSYLFTKSLAFAGSTSTPPVFEWLL
AAASLPLTVLAFTLLYVYLPNCTVAWRDAVVGGVCAALAFELAKRGFGYYVRRIPTYTAV
YGAFATVPMFLLWLYLSWFVTLAGAMIASALPAIRVGQFHRIHYPGSDLLDSLELLARLA
DAQQAGKPGHTAARLALMARCDMETAQRLLSTLEEREWVARLQSGNDAAPRYVMLANPER
LTVANLFDVLVIDRSELVYQAQRGRTEVDCATLVDAFTSEKLDLSLAELIARRRQGASRD
APGAAHSTSALPPRTA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttgccgaagttgagcgtcgatctcgacaccatcaagcgtctcgcgcgcttcgccgcgaag
cgcagcgcggaagaccgcatcccgcaggtcgcgggcagcctcacgttcacgacgatgctc
gcgctcgtgccgctcgtgacggtcgccttcgcgctcttcaccgcgttcccgatgttcgcg
tcgttccagaattcgctgcagggcttcctcgccgatcacctgatgcccgcgcagttcaac
agccagatcttcaagtacctgaaccagttcgcgtcgaaggcgaaggggctgacgacggcg
ggcctcatcgtgctcgtcttcaccgcggtgatgatgatgacgatcgaatccgcgttcaac
ctgatctggcgcgtgcgcaagccgcgcccgttcgcgcagcgcgtgctcgcgtactgggcg
ctgatcacgctcgggccgctgctgttcggcgtgagcctgtcgatgtcgtcgtacctgttc
acgaaatcgctcgcgttcgccggctcgacgagcacgccgccggtcttcgaatggctgctg
gcggccgcgtcgctgccgctcacggtgctcgcgttcacgctgctctacgtgtatctgccg
aactgcacggtcgcgtggcgcgacgcggtggtgggcggcgtgtgcgcagcgctcgcgttc
gagctcgccaagcgcggcttcggctactacgtgcggcgcattcccacttacacggcggtg
tacggcgcgttcgcgaccgtgccgatgtttctgctgtggctgtatctgagctggttcgtc
acgctcgcgggcgcgatgatcgcgtcggcgctgccggcgatccgggtcgggcagttccac
cggatccattacccgggcagcgatctgctcgactcgctcgagctgctcgcgcggctcgcc
gacgcgcagcaggcgggcaagccgggccacacggccgcgcggctcgcgctgatggcgcgc
tgcgacatggaaaccgcgcagcggcttttgtcgacgctcgaggagcgcgaatgggtcgcg
cggctgcaaagcggcaacgacgccgcgccgcgctacgtgatgctcgcgaacccggagcgg
ctgacggtcgcgaacctgttcgacgtgctcgtgatcgaccgctccgagctcgtctaccag
gcgcagcgcggccggaccgaggtcgattgcgcgacgcttgtcgatgcgttcacgagcgag
aagctcgatctgtcgctcgcggagctgatcgcgcgccgcaggcagggcgcgtcgcgcgac
gcaccgggcgcggcgcactcgacgtccgcgctgccgccgcgcaccgcgtga

DBGET integrated database retrieval system