KEGG   Burkholderia mallei NCTC 10247: BMA10247_2557Help
Entry
BMA10247_2557     CDS       T00479                                 

Definition
(GenBank) THUMP domain protein
  KO
K07444  putative N6-adenine-specific DNA methylase [EC:2.1.1.-]
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BMA10247_2557
Enzymes [BR:bmn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     BMA10247_2557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 THUMP Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ABO04406
LinkDB All DBs
Position
I:complement(2527729..2529021)
Genome map
AA seq 430 aa AA seqDB search
MSSPTLFDFFAPCPRGLEAALAAELAQIAARHAIAPYDAGAQVPGGVHFRGAWAAGMAAN
LHSRIASRVLLKIAHRPYRNEQDVYALALEQPWERWFASTQTLRVDITAIKSPLKSLEFA
TLRVKDAICDRLREKTGARPSIDTAQPDVRVFAFLTAGDCTLYLDTSGEPLFKRGWRLDK
GAAPLRENLAAGILRLAGWTPGTPLYDPMCGSGTFVAEAAQIALGVAPGVERRFGFEKLK
QYDITAWQTLKVAAMDAKRAARGKRDDLLIFGSDISGDMLEKARANLERAGVPSLWLKQI
DARNMTPPAAAPGVIVTNPPYGERIEVRGRGPRGDVRETGKNRGGDEAFRRTHADSPDSE
FFRALGDALKQRFAGWQAFMLSSDRTLPGQLRLRESAKTPLFNGALECRLFRFDLIAGSI
RQRPAAADGE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgccgaccctattcgacttcttcgctccctgcccgcgcgggctcgaggccgcg
ctcgccgccgagctcgcgcagatcgccgcgcgccacgcgatcgccccgtacgacgcgggc
gcgcaagtgccgggcggcgtgcatttccgtggcgcctgggcggccggcatggccgccaac
ctgcattcgcggatcgcgagccgcgtgctgctgaagatcgcgcaccgcccgtaccgcaac
gagcaggacgtctacgcgctcgcgctcgagcagccgtgggagcgctggttcgcatcgacg
cagacgctgcgcgtggacatcaccgcgatcaagtcgccgctcaagagcctggaattcgcg
acgctgcgcgtgaaggacgcgatctgcgaccgcctgcgcgagaagacgggcgcccgcccg
agcatcgacaccgcccagcccgacgtgcgcgtgttcgcgttcctgacggcgggcgactgc
acgctgtatctcgacacgtccggcgagccgctcttcaagcgcggctggcgtctcgacaag
ggcgcggcgccgctgcgcgagaatctcgcggcgggcatcctgcgcctggccggctggacg
ccgggcacgccgctctacgatccgatgtgcggcagcggcacgttcgtcgcggaagccgcg
cagatcgcgctcggcgtcgcgccgggcgtcgagcgccgcttcggcttcgagaagctcaag
caatacgacatcaccgcgtggcagacgctgaaggtcgccgcgatggacgcgaagcgcgcg
gcgcgcggcaagcgcgacgatctgctgatcttcggcagcgacatctcgggcgacatgctc
gagaaggcgcgcgcgaacctcgagcgcgcgggcgtgccgtcgctgtggctcaagcagatc
gacgcgcgcaacatgacgccgcccgccgccgcgcccggcgtgatcgtcacgaacccgccg
tacggcgagcggatcgaggtgcgcggccgcggcccgcgcggcgacgtgcgcgagacgggc
aagaaccgcggcggcgacgaagccttccgccgcacgcacgccgattcgcccgacagcgaa
ttcttccgcgcgctcggcgatgcgctcaagcagcgcttcgccggctggcaggcgttcatg
ctgagctcggaccgcacgctgccgggccagttgcgactgcgcgaatcggcgaagacgccg
ttgttcaacggcgcgctcgagtgccggctgttccgtttcgatctgatcgcgggcagcatc
cggcaacgcccggcagcggccgacggcgagtaa

DBGET integrated database retrieval system