KEGG   Burkholderia mallei NCTC 10247: BMA10247_2797Help
Entry
BMA10247_2797     CDS       T00479                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmn01100  Metabolic pathways
bmn01110  Biosynthesis of secondary metabolites
bmn01130  Biosynthesis of antibiotics
bmn01230  Biosynthesis of amino acids
Module
bmn_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMA10247_2797 (aroK)
Enzymes [BR:bmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BMA10247_2797 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 AAA AAA_25 FtsK_gamma AAA_16 APS_kinase AAA_22 TsaE Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: ABO06139
LinkDB All DBs
Position
I:complement(2748883..2749416)
Genome map
AA seq 177 aa AA seqDB search
MNVIFVGLMGAGKTTVGRAVARRLDRPFFDSDHEIEARTGARIPVIFELEGEAGFRDREA
QMIAELTQRENIVLATGGGAILRPENRKLLHERGLVVYLRANPHDLWLRTRKDKNRPLLQ
TDDPKAKLEALYEARDPLYRECAHFVIETGRPSVNGLVNMVLMQLEMAGIVAKPLQA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtaattttcgtcgggctcatgggggcgggtaagaccaccgtgggccgggcggtc
gcgcgccggctcgacagacccttcttcgattcggatcacgagatcgaggcgcgcaccggc
gcgcgcattccggtcatcttcgaactcgagggcgaagcgggcttccgtgaccgcgaggcg
cagatgatcgccgagctcacgcagcgcgagaacatcgtgctggcgacgggcggcggcgcg
atcctgcgccccgagaaccgcaagctgcttcacgaacggggcctcgtcgtctatctgcgc
gcgaatccgcacgatctctggctgcgcacccgcaaggacaagaatcgcccgctgttgcag
accgacgatccgaaagccaagctcgaagcgctgtacgaagcgcgcgatccgctctaccgc
gaatgcgcgcacttcgtcatcgaaaccgggcggccgtccgtcaacgggctcgtcaacatg
gtgctgatgcagctcgaaatggcgggcatcgtcgccaagccactccaagcatga

DBGET integrated database retrieval system