KEGG   Burkholderia mallei NCTC 10247: BMA10247_3050Help
Entry
BMA10247_3050     CDS       T00479                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00010  Glycolysis / Gluconeogenesis
bmn00620  Pyruvate metabolism
bmn01100  Metabolic pathways
bmn01110  Biosynthesis of secondary metabolites
bmn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10247_3050
   00620 Pyruvate metabolism
    BMA10247_3050
Enzymes [BR:bmn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BMA10247_3050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABO04802
LinkDB All DBs
Position
I:complement(3014018..3015637)
Genome map
AA seq 539 aa AA seqDB search
MHRGAACWHGFVVTNGVAHVARRITDTDMRGATMNHADMQHLNIEFPYRKQYGNFIGGEW
VAPVGGEYFDNVSPVTGRPFTAIPRSREADIELALDAAHAAKAGWAAKGAAERANVLLRI
ADRMEANLTRLAVAETIDNGKPLRETTAADVPLAIDHFRYFAGCIRAQEGSIADIGGDMV
AYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALAAGNCVVLKPAEQTPASILVFAELIQDL
LPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTGETSTGRLIMQYASENLIPVTLELGGKS
PNIFFADVMDRDDSYFDKALEGFAMFALNQGEVCTCPSRALVEESIYDRFIERALKRVEA
IKQGHPLDSQTMIGAQASAEQLEKILSYIDIGRGEGAQCLTGGERNVLGGELAEGYYVKP
TVFRGHNKMRIFQEEIFGPVLAVTTFKTEEEALEIANDTLYGLGAGVWTRDGNRAYRFGR
GIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcggcgcggcgtgctggcacggttttgtcgtaacgaacggcgtcgcgcacgtc
gcgcggcgcatcaccgataccgacatgcgaggagcaacgatgaatcacgcggacatgcaa
catctgaacatcgaattcccgtaccgcaagcagtacgggaatttcatcggcggcgaatgg
gtcgccccggtcggcggcgagtatttcgacaacgtctcgcccgtcaccggccggccgttc
accgcgatccctcgctcgcgcgaagccgacatcgagctcgcgctcgacgccgctcacgcg
gccaaggcgggctgggccgcgaagggcgcggccgagcgcgcgaacgtgctgctgaggatc
gccgaccggatggaggcgaacctcacgcgcctcgccgtcgccgagacgatcgacaacggc
aagccgctgcgcgaaaccaccgcagccgacgtgccgctcgcgatcgaccacttccgctac
ttcgcgggctgcatccgcgcgcaggaaggctcgatcgccgatatcggcggcgacatggtg
gcctaccacttccacgagccgctcggcgtcgtcggccagatcatcccgtggaacttcccg
ctgctgatggccgcgtggaagctcgcgccggcgctcgcggccggcaactgcgtcgtgctc
aagccggccgagcagacgcccgcgtcgatcctcgtgttcgccgagctgatccaggatctg
ctgccgcccggcgtgctcaacatcgtcaacggcttcggcctcgaggccggcaagccgctc
gcgtcgagcaagcggatcgcgaagatcgcgttcacgggcgagacgtcgacgggccgcctc
atcatgcagtacgcgagcgagaacctgattcccgtcacgctcgagctgggcggcaagagc
ccgaatattttcttcgccgacgtgatggatcgcgacgacagctacttcgacaaggcgctc
gaaggcttcgcgatgttcgcgctgaaccagggcgaagtctgcacgtgcccatcgcgcgcg
ctcgtcgaggagagcatctacgatcgcttcatcgaacgcgcgctcaagcgcgtcgaggcg
atcaagcagggccatccgctcgattcgcagacgatgatcggcgcgcaggcgtcggccgag
cagctcgagaagatcctgtcgtacatcgacatcggccgcggcgaaggcgcgcaatgcctg
acgggcggcgagcgcaacgtgctcggcggcgagctcgccgaaggctattacgtgaagccg
accgtgttccgcggccacaacaagatgcgcatcttccaggaagaaatcttcgggccggtg
ctcgcggtgacgacgttcaagaccgaggaggaagcgctcgagatcgcgaacgacacgctg
tacggcctgggcgccggcgtctggacgcgcgacggcaaccgcgcgtaccgcttcggccgc
ggcatccaggcgggccgcgtgtggacgaactgctatcacgcgtatccggcgcacgcggcg
ttcggcggctacaagcaatccggcatcggccgcgagacgcacaagatgatgctcgaccac
taccagcagacgaagaacctgctcgtcagctacagcgaaaagccgctcgggttcttctga

DBGET integrated database retrieval system