KEGG   Burkholderia mallei NCTC 10247: BMA10247_A2026
Entry
BMA10247_A2026    CDS       T00479                                 

Gene name
pepM
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00440  Phosphonate and phosphinate metabolism
bmn00998  Biosynthesis of various secondary metabolites - part 2
bmn01100  Metabolic pathways
bmn01110  Biosynthesis of secondary metabolites
bmn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BMA10247_A2026 (pepM)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BMA10247_A2026 (pepM)
Enzymes [BR:bmn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BMA10247_A2026 (pepM)
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD L27
Other DBs
NCBI-ProteinID: ABO02212
UniProt: A0A6C6YJW9
LinkDB
Position
II:1959666..1961354
AA seq 562 aa
MNAREPNFTESRSARLRRMLTSPSLEFLMEAHNGLSARIVREAGFKDIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAQAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIQDSETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSS
ARASSAALVLAASRGNGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAQTGELASLACAAERLTGDTIISYGDLLFRSYILRDLAESEAQ
FSVVVDSSQTQPSNQSVRDFAFCSAADDRGLFGQKAYLRRVSSDASEAAPHGRWIGLLNV
RGAGVARLKAMLGTLQARDDFDALDLPALLNALVDAGEQIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNAGSGSAR
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaacttcaccgaatcgcgcagcgcgcggctgcggcggatgctg
acgagcccgtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcgcatcgtc
cgcgaggcgggcttcaaggacatctgggcgtcggggctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaggcgagctggacacaggtggtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccggctcgtgagaaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagtttccgaaaaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctggggcatggacgaggcgctgcgccgc
gcgaacgcgtatgcgcaggccggcgccgatgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgagaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggcgggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtccgcttccgcgatgcaggcggtcgcccgcgaa
atccaggacagcgaaacgctcgtcaacgtcgaggaacgcgtggcgagcgtcaacgagatc
ttccggctgcaggacgccgacgaatactcggccgccgagcgcatctacctgtcgtcgagc
gcgcgcgcgtcgagcgcggcgctcgtgctcgccgcgagccgcggcaacgggctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgccggtcgccggcaagccgctgttgcgctgg
ctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggctaccgc
gccgatgcgatcgacacgtccggcgtgaagctcgtcgtcaacgagcggcacgcgcaaacg
ggcgagctcgcgtcgctcgcctgcgcggccgagcgtctgacgggcgacaccatcatctcg
tacggcgatctgctgtttcgcagctacatcctgcgcgacctcgcggaaagcgaggcgcag
ttcagcgtcgtcgtcgattcgtcgcagacgcagccgtcgaaccagagcgtgcgcgatttc
gcattctgctcggccgccgacgaccgcgggctgttcggccagaaagcgtacctgcgccgc
gtgtcgagcgacgcgagcgaggccgcgccgcacgggcgctggatcggcctgctgaacgtg
cgcggcgcgggcgtcgcgcggctgaaggcgatgctcggtacgctccaggcgcgcgacgat
ttcgatgcgctcgacctgccggcgctgctgaacgcgctcgtcgacgcgggcgagcagatc
gaagtgcagtacgtgcacggccattggcgcggcgtcaacgatctcgacgacttccgccgc
gcgggcgacttcgcgcacggccagacgccgtacgcggagcagaacgcgggcagcgggagc
gcacgatga

DBGET integrated database retrieval system