KEGG   Burkholderia mallei NCTC 10247: BMA10247_A2072Help
Entry
BMA10247_A2072    CDS       T00479                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BMA10247_A2072
Enzymes [BR:bmn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BMA10247_A2072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc PALP
Motif
Other DBs
NCBI-ProteinID: ABO02928
LinkDB All DBs
Position
II:complement(2005752..2006888)
Genome map
AA seq 378 aa AA seqDB search
MPQTAEAPPQRAAERGETPALPATMRAVVCHGPQDYRLEQVPVPKPGPDEILTQVERVGI
CMGDIKTFRGAPSFWGDAVQPRYVKPPMIPGHEFVCRVVALGPGAERRGVKVGDRVISEQ
IVPCWSCRFCGHGQYWMCQKHDLYGFQNNVHGAMAEYMIFTKEAIVHRVPDSIPTDEAIL
IEPLSCSLHAADRANVGFDDVVVVAGAGTLGLGIIGAARLRHPKQLIVLDMKPERAALAR
RMGADDVWNPAEENVIEKIRAITGGYGCDIYIEATGHHRAVGQGLAMLRKLGRFVEFSVF
NDEASVDWSIIGDRKELDVLGSHLGPYMYPRAIEFIASRRIDVRGIVTHTFPLSRFADAF
AVMERGKQSLKVVLDPRG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgccacagacagccgaagcgccgccgcaacgcgcggccgagcgcggcgagacgcccgcg
ctgcccgccacgatgcgcgccgtggtttgccacggcccgcaagactaccgcctcgagcag
gtgccggtgccgaagccggggccggacgagatcctgacccaggtggagcgcgtgggcatc
tgcatgggcgacatcaagacgtttcgcggcgcgccgtcgttctggggcgacgcggtgcag
ccgcgctacgtgaagccgccgatgattcccggccacgaattcgtgtgccgcgtcgtcgcg
ctcggccccggcgccgagcggcgcggcgtgaaggtgggcgatcgcgtgatctccgagcag
atcgtgccgtgctggagctgccgcttctgcggccacggccagtactggatgtgccagaag
cacgatctgtacggattccagaacaacgtgcacggcgcgatggccgaatacatgatcttc
acgaaggaggcgatcgtgcaccgcgtgcccgattcgatcccgaccgacgaggcgatcctg
atcgagccgctgtcgtgctcgctgcacgcggccgatcgcgcgaacgtcggcttcgacgac
gtggtcgtcgtcgccggcgcgggcacgctcgggctcggcatcatcggcgcggcgcggctg
cgccatccgaagcaactgatcgtgctcgacatgaagcccgagcgcgcggcgctcgcgcgc
cggatgggcgcggacgacgtgtggaacccggccgaggagaacgtgatcgagaagatccgc
gcgatcacgggcggctacggctgcgatatctacatcgaggcgaccggccaccatcgcgcg
gtaggccaggggctcgcgatgctgcgcaagctcgggcgcttcgtcgagttcagcgtgttc
aacgacgaagcgagcgtcgactggtcgatcatcggcgatcgcaaggagctcgacgtgctc
ggctcgcatctcggcccgtacatgtacccgcgcgcgatcgagttcatcgcatcgcgcagg
atcgacgtgcgcggcatcgtcacgcacacgttcccgctgtcgcgcttcgccgacgcgttc
gcggtgatggagcgcggcaagcaatcgttgaaggtcgttctggatccgcgaggttaa

DBGET integrated database retrieval system