KEGG   Burkholderia mallei NCTC 10247: BMA10247_A2346Help
Entry
BMA10247_A2346    CDS       T00479                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00550  Peptidoglycan biosynthesis
bmn01100  Metabolic pathways
bmn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BMA10247_A2346
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BMA10247_A2346
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bmn01003]
    BMA10247_A2346
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmn01011]
    BMA10247_A2346
Enzymes [BR:bmn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BMA10247_A2346
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BMA10247_A2346
Glycosyltransferases [BR:bmn01003]
 Polysaccharide
  Bacterial polysaccharide
   BMA10247_A2346
Peptidoglycan biosynthesis and degradation proteins [BR:bmn01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BMA10247_A2346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ABO01962
LinkDB All DBs
Position
II:complement(2277532..2280066)
Genome map
AA seq 844 aa AA seqDB search
MNRRIVSSFLERCAAWLAAAKPHAVAVLHRLRHPTRRGVLLAVAALPALCVLYVLALIPF
TPSIGDIRKARVDAPAQILSADGKLLAEFKPSNREWVPLADISPKMVDALISTEDHRFYE
HHGLDWRRTAGAALRTFSGDRQGGSTITQQLARNLYPDEIGRAPTLTRKLKEAITALKIE
AVYSKAQILETYLNTVPFLYNAYGVEMAARTYFDKSADQLDALDAATLVGMLKGNSYYNP
VLNPERALARRNTVLAQMVKYGRLSPAAYASLQKKPLRIDFERQKEPPGPAPHFAQQLRK
WLIAWADRNDYNIYSDGLVVRTTIDSRLQTYATQALARQTNQLQGVANGMWNAGSGCAPG
NPLFRAFVRETPEFRAALDGGATGDAALKRLLADRGFARALCKAKADVQAGFLAIDPRNG
QIKAWVGSRDFTAEPFDHVQQARRQPGSTFKPFVYGAAFAAGATPDDTFVDQPVEIPLAG
GEIWRPDDDAPPTNKPMTLRDAIAYSRNRITAQLMMKVGPQKVARLARAMGVRDSALDAV
PSLALGTSPVTLKEMVSAYATIANVGEYVEPRMVTRIEGRNGEVLAEFASATPERALDAA
AARTLIDVMRGVVERGTGAAIRSRYGIRADVAGKTGTTQGDTDGWFILMQPELVAGAWVG
FDDGRVTLGGDWGQGARSALPIVGDFYQRAIRARLVDTRERFATEAPPSAFDTFRNKLGD
WYRYLFEKPEPPRKAAPPKAPRAPLEEVMPASEVEAASAAVARAASEAAAVASAASTASA
APPASGVPFAPGGASAPALPPLLPPMPQSAPLPPAAQPGSSLPNDNAPMSPTPTPDAPAA
GGSN
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgccgaatcgtgtcgtccttcctcgagcgttgcgcggcctggctcgccgccgcg
aagccgcacgccgtcgccgtcctgcaccgcctgcgccacccgacgcggcgcggcgtgctg
ctcgccgtcgccgctctccccgcgctgtgcgtgctctacgtgctcgcgctgatcccgttc
acgccgagcatcggcgacatccgcaaggcgcgcgtcgacgcgcccgcgcagatcctgtcc
gccgacggcaagctgctcgccgagttcaagccgtcgaaccgcgaatgggtgccgctcgcc
gacatctcgccgaagatggtcgacgcgctgatctcgaccgaggaccatcgcttctacgag
caccacggcctcgactggcggcgcaccgcgggcgccgcgctgcgcacgttctccggcgac
cggcagggcggctcgacgatcacgcagcagctcgcgcgcaacctgtatccggacgagatc
ggccgcgcgccgacgctcacgcgcaagctgaaggaagcgatcaccgcgctgaagatcgag
gcggtctacagcaaggcgcagatcctcgagacgtatctgaacacggtgccgttcctgtac
aacgcgtacggcgtcgagatggccgcgcgcacgtacttcgacaaatcggccgaccagctc
gacgcgctcgacgcggcgacgctcgtcggcatgctcaagggcaacagctattacaacccg
gtgctaaaccccgagcgcgcgctcgcgcgccgcaacacggtgctcgcgcagatggtgaag
tacggcaggctctcgcccgccgcgtatgcgtcgctgcagaagaagccgctgcgcatcgat
ttcgagcggcagaaggagccgcccggccccgcgccgcatttcgcgcagcaactgcgcaag
tggctgatcgcgtgggccgaccgcaacgattacaacatctactccgacggcctcgtcgtg
cgcacgacgatcgattcgcggctgcagacgtatgcgacgcaggcgctcgcgcgtcagacc
aaccagctgcagggcgtcgcgaacgggatgtggaacgccggcagcggctgcgcccccggc
aatccgctgtttcgcgcattcgtgcgcgagacgccggagttccgcgcggcgctcgacggc
ggcgcgaccggggacgccgcgctcaagcgcctgctcgccgaccgcggcttcgcgcgcgcg
ctctgcaaggcgaaggccgacgtgcaggcgggctttctcgcgatcgatccgcgcaacggg
cagatcaaggcgtgggtcggcagccgcgatttcacggccgagccgttcgatcacgtgcag
caggcgcgccggcagccgggctcgacgttcaagccgttcgtctacggcgcggcgttcgcg
gcgggcgcgacgcccgacgatacgttcgtcgatcagccggtcgagatcccgctcgcgggc
ggcgagatctggcggcccgacgacgacgcgccgcccacgaacaagccgatgacgctgcgc
gacgcgatcgcgtactcgcgcaaccggatcaccgcgcaactgatgatgaaggtcggcccg
cagaaggtggcgcgcctcgcgcgcgcgatgggcgtgcgcgacagcgcgctcgatgcggtg
ccgtcgctcgcgctcggcacgagccccgtgacgctcaaggagatggtgtccgcctacgcg
acgatcgcgaacgtcggcgaatacgtcgagccgcggatggtcacgcgcatcgagggccgc
aacggcgaggtgctcgccgagttcgcgagcgcgacgcccgagcgcgcgctcgacgcggcg
gcggcgcgcacgctgatcgacgtgatgcgcggcgtcgtcgagcgcggcaccggcgcggcg
atccgctcgcgctacgggattcgcgcggacgtcgccggcaagaccggcacgacgcagggc
gacaccgacggctggttcatcctgatgcagcccgagcttgtcgcgggcgcgtgggtcggc
ttcgacgacggccgcgtgacgctaggcggcgattgggggcaaggcgcgcgcagcgcgctg
ccgatcgtcggcgatttctatcagcgggcgattcgcgcgcggctcgtcgatacgcgcgaa
cgcttcgcgaccgaagcgccgccgagcgcgttcgacacgttccgcaacaagctcggcgac
tggtatcgctacctgttcgagaagcccgagccgccgcgcaaggccgcgccgccgaaagcg
ccgcgcgcgccgctcgaggaggtgatgccggcttccgaggtcgaggcggcgtcggcggcg
gtcgcgcgcgccgcgtcggaagcggctgcagtggcatcggccgcgtcgaccgcatcggcc
gcaccgccggcgagcggcgtgccgttcgcgccgggcggcgcgtcggcgccggcgctgccg
ccgctgttgccgccgatgccacagtctgctccgttgccgcctgccgcgcagccgggcagc
agcctgccgaacgacaacgcgccgatgtcgccgacgccgacgcccgatgcgccggccgcg
ggcggcagcaattag

DBGET integrated database retrieval system