KEGG   Borrelia miyamotoi LB-2001: I871_01050Help
Entry
I871_01050        CDS       T02797                                 

Definition
(GenBank) D-alanyl-alanine synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bmo  Borrelia miyamotoi LB-2001
Pathway
bmo00473  D-Alanine metabolism
bmo00550  Peptidoglycan biosynthesis
bmo01100  Metabolic pathways
bmo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    I871_01050
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    I871_01050
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    I871_01050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmo01011]
    I871_01050
Enzymes [BR:bmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     I871_01050
Peptidoglycan biosynthesis and degradation proteins [BR:bmo01011]
 Precursor biosynthesis
  Amino acid ligase
   I871_01050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AGT27194
LinkDB All DBs
Position
complement(198520..199629)
Genome map
AA seq 369 aa AA seqDB search
MKGFDTMRKNLMLIFGGVSFEHEVSLRSAYGIYSAIVKIDKYNVFSSFIDKYSGVWYLLD
SSIPDDPALIKRDSSAIISLIPGCGIFVNNRDLKIDVVFPIVHGRTGEDGSIQGLLKMMD
IPCVGSGILGSAIASNKYFCKLLLKSFNLPLIPFVGFREYDYLLDKDGIKKDIRQNLGYP
VIVKPAMLGSSIGISIAYDDIQIEKCIEEAFKYDLTIIAEKFMQVREIECSVIGNDQIRI
FTPGEIVIQDFLFYDYDAKYSTIPGNSVIFDIPAHLDTKHLLDIKEYAYLTYRCLELRGM
ARIDFLIEKDTDLIYINEINTIPGFTDISMFSKMCEHDGLDYESLLDKLITLAFQSYEKE
KNNIDFRPL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggatttgatactatgagaaaaaatcttatgttaatatttggaggggtttctttt
gagcatgaagtttctcttagatctgcttatgggatttattcagctattgtgaagattgat
aagtataatgtattttcaagttttattgacaaatattctggggtttggtatttactggat
tcttctattcctgatgatcctgcattaattaaaagagatagttctgccattattagttta
attcctggttgtggaatatttgttaataatagggatcttaaaattgatgttgtgtttcct
attgttcatgggagaacaggtgaggatggttctattcagggacttttaaaaatgatggat
attccttgtgttggttctggtattttaggaagtgctattgctagtaataaatatttctgt
aagcttttacttaaaagttttaatcttcccttaattccttttgttggatttagagaatat
gattatcttttagataaagatgggataaaaaaagatataaggcaaaatttgggatatcct
gtaattgtaaagccagctatgctggggtcttcaattgggataagtattgcatatgatgat
attcagattgaaaaatgcattgaggaagcttttaagtatgatttaacaattatagcagag
aagtttatgcaagtaagagaaattgaatgttctgttattggaaatgatcaaattagaata
tttactcctggtgaaattgtcatacaagattttttattttatgactatgatgctaaatat
tctactatccctggaaattctgttatatttgatattcctgctcatcttgatactaagcat
ttgttagacattaaggagtatgcatatctgacttatagatgtttagagcttaggggtatg
gcaagaattgattttttaattgaaaaagatactgatttaatttatattaatgaaataaat
acaattccaggatttacagatatttcaatgttttctaagatgtgtgaacatgatggtctt
gattatgaatctttgcttgataaattgataactttagcttttcagagttatgaaaaggaa
aagaataacattgattttaggccgttataa

DBGET integrated database retrieval system