KEGG   Borrelia miyamotoi LB-2001: I871_01295Help
Entry
I871_01295        CDS       T02797                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bmo  Borrelia miyamotoi LB-2001
Pathway
bmo00564  Glycerophospholipid metabolism
bmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    I871_01295
Enzymes [BR:bmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     I871_01295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AGT27238
LinkDB All DBs
Position
249467..251032
Genome map
AA seq 521 aa AA seqDB search
MSKNQKTELKDLDNQDFDLIIVGGGATGLGIGIDSITRGYKTLLIEKFDYAKGTSSRSTK
LIHGGVRYLAQFNLSLVKEALHEQALLEQNAPHLVNKLGFITPIYNLLNLPYYYLGLSWY
HTLLGKDKKSKYRTKLLSKSKTIEKMPNIKTKGLKCSVLYYDNSFDDARMAISMFRTFTE
KGGIAFNYTALTKFTKTKNGKISGAIIHDKIIKEQVIVNSKCIINATGIFSDEIRKLDDP
NATNIIKPSQGTHIVINKNKFNTECAMLIPKTSDNRILFTVPWYNGIVCGSTDILVDKIE
EEPKSLKSAIEFIIDNMNNYLDIKITKNDILSTYTGIRPLISDSKKTQNTSKISRSEKIF
VSKSNLITIAGGKYTTYRKMAEKVLKKAIEEKLIPESKSITENLRLHGYIKKEEALKIPE
HFRTYGSDFKYLSKMQDFNNKIHKDLPLNDAQITFAIEFEQAKTVEDILSRRTRSLFLNA
KATIEATPKVAEIMMYKLGKSEEWKNEQIKSFKEIAIKYLV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaatcaaaaaacagaattaaaagatcttgacaatcaagactttgatttaata
atagttggtgggggagcaactggccttggcattggaatagactcaattacgagaggatac
aaaactttactaattgaaaaatttgactatgcaaaaggtacctcttctagatcaactaaa
ctaatacacggaggagtaagatacttagctcaatttaatttatccttagtaaaagaagcc
ttacatgagcaagcactacttgaacaaaatgcacctcacctagtcaataagcttggattt
attacacctatatacaatctcctaaatcttccatactactatcttggattaagttggtac
catacacttcttggaaaagataaaaaatccaaatatagaacaaaactactatcaaaatct
aagacaatagaaaaaatgccaaatattaaaactaaaggtcttaaatgctctgttctgtac
tacgacaattcatttgatgacgctagaatggcaataagcatgtttagaactttcacggaa
aaaggaggtattgcattcaattatacagcacttacaaaatttaccaaaacaaaaaatggc
aaaatatcaggtgcaattattcatgataaaataattaaagaacaagttatcgttaacagt
aagtgtataatcaatgcaacaggaatcttttcagatgagattagaaagttagatgatcct
aatgctactaatattataaaaccttcccaaggaacacatatagtaattaacaaaaataaa
ttcaatacagaatgtgcaatgcttatacctaaaacaagtgataatagaattttatttact
gtaccttggtataatggcattgtttgtggaagcacagatattttagtagataaaattgag
gaagaacccaagagcctaaaaagtgcaattgaattcataatagacaatatgaataattac
ttagatattaaaataaccaaaaatgatattttaagtacttatacagggattaggccctta
atatcagattcaaaaaaaacacaaaatacctcaaaaatatcaagaagcgaaaaaatattc
gtatcaaaatcaaatcttattacaattgctggagggaaatatactacttacagaaagatg
gctgaaaaagttctaaaaaaagcaatagaagaaaaactaatacctgagtcaaaatctata
acagaaaatttaaggctacacggatacataaaaaaagaagaagcactcaaaatacctgaa
cactttagaacttatggaagtgattttaaatatttaagcaaaatgcaagactttaacaat
aagattcacaaggacttgccattaaatgacgctcaaataacctttgctattgaatttgag
caagcaaaaactgttgaagacatcttatcaagaagaacaagatctctcttccttaatgca
aaagccacaattgaagctacaccaaaggttgctgaaattatgatgtacaaacttggcaaa
tctgaggaatggaaaaatgaacaaataaaaagctttaaagagatagcaataaaatatttg
gtttaa

DBGET integrated database retrieval system